(data stored in ACNUC7421 zone)

EMBL: CP000859.PE237

CP000859.PE237       Location/Qualifiers
FT   CDS             260928..263939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0237"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sfu:Sfum_0929 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66047"
FT                   /db_xref="GOA:A8ZS29"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS29"
FT                   /protein_id="ABW66047.1"
FT                   /translation="MIPLTVRSGYSLMWGTAPIKEVCRVARQQGYDRLALTDTDNLYGL
FT                   WHFLDACRRNDITPVVGAELTDPATTDRAVLLVKNPEGYKNLCRLITARHLEPDFKLET
FT                   AIARHADGLAVLTRNPCHLKQWHESGVAVYGAMPRRPMSLSSPLCQTARYLNVPLVATP
FT                   GSFFLSPQDMDAHRMLRAIDLNTTVDRLGPLEAAPGEAWLASPREYEKRFEACPEALAN
FT                   TRRLSETLTFTGPEFGLVMPPWESKTGTDPGSALRQAAYRGAQARYGRDLPEPVARRLE
FT                   HELSIIIQMRFAAYFLVVQDIVRLSPRICGRGSGAASLVAYCLRITNVCPIKHNLYFER
FT                   FLNPGRKDAPDIDVDFAWDERDTVLAAVFERFGDHCAMVCNHVRMQPRMAVREVARVYG
FT                   LTEAEISRVTKKMPWFWRQDTAGLDILRELSERPESRDLDLPAPWPGIMAVARKICGAP
FT                   RYLSVHPGGVIITPRPVCEYVPVERAAKGVRIIQWEKDQAEDAGLVKIDLLGNRSLAVI
FT                   RDAIYNLRSNNHLLDESTWAPEDDFATQEAVSQGKTMGCFYIESPATRLLQKKSRVGDF
FT                   EHLVIHSSIIRPAANDYIQEYLRRLHGASWDPIHPLLADVLDETFGIMVYQEDVSRAAV
FT                   SVAGFSHADADGLRKVMSKKDKDHVLADFYRRFADGAAKNGVTPEKIREIWRMMMSFSG
FT                   YSFCKPHSASYARVSFQAAWLKTHYPAAFMAAVISNQGGFYSTFAYVSEARRSGITILA
FT                   PDVNASDIRWQGNGNTIRVGLSAVGHLSLKTMEKTLAHRKAARFTGLEDYMDRVRPDEP
FT                   EAQALIQSGAFDALCPGRSRSMIRWQWACWKNNRPPASSSPLLFDTAPGPVVPPPQITE
FT                   DPLERYRQEFSVLGFLCDTHPMTLYKTELEGRQTIKAKHLGRYAGKRVCVAGWLITGKV
FT                   VRTKNGDPMEFLTFEDETDIFEATFFPKTYTRFCHMIDRGSPFLLWGTVETNWGAVTLT
FT                   VEKIEGLPDYNNRL"
     MIPLTVRSGY SLMWGTAPIK EVCRVARQQG YDRLALTDTD NLYGLWHFLD ACRRNDITPV        60
     VGAELTDPAT TDRAVLLVKN PEGYKNLCRL ITARHLEPDF KLETAIARHA DGLAVLTRNP       120
     CHLKQWHESG VAVYGAMPRR PMSLSSPLCQ TARYLNVPLV ATPGSFFLSP QDMDAHRMLR       180
     AIDLNTTVDR LGPLEAAPGE AWLASPREYE KRFEACPEAL ANTRRLSETL TFTGPEFGLV       240
     MPPWESKTGT DPGSALRQAA YRGAQARYGR DLPEPVARRL EHELSIIIQM RFAAYFLVVQ       300
     DIVRLSPRIC GRGSGAASLV AYCLRITNVC PIKHNLYFER FLNPGRKDAP DIDVDFAWDE       360
     RDTVLAAVFE RFGDHCAMVC NHVRMQPRMA VREVARVYGL TEAEISRVTK KMPWFWRQDT       420
     AGLDILRELS ERPESRDLDL PAPWPGIMAV ARKICGAPRY LSVHPGGVII TPRPVCEYVP       480
     VERAAKGVRI IQWEKDQAED AGLVKIDLLG NRSLAVIRDA IYNLRSNNHL LDESTWAPED       540
     DFATQEAVSQ GKTMGCFYIE SPATRLLQKK SRVGDFEHLV IHSSIIRPAA NDYIQEYLRR       600
     LHGASWDPIH PLLADVLDET FGIMVYQEDV SRAAVSVAGF SHADADGLRK VMSKKDKDHV       660
     LADFYRRFAD GAAKNGVTPE KIREIWRMMM SFSGYSFCKP HSASYARVSF QAAWLKTHYP       720
     AAFMAAVISN QGGFYSTFAY VSEARRSGIT ILAPDVNASD IRWQGNGNTI RVGLSAVGHL       780
     SLKTMEKTLA HRKAARFTGL EDYMDRVRPD EPEAQALIQS GAFDALCPGR SRSMIRWQWA       840
     CWKNNRPPAS SSPLLFDTAP GPVVPPPQIT EDPLERYRQE FSVLGFLCDT HPMTLYKTEL       900
     EGRQTIKAKH LGRYAGKRVC VAGWLITGKV VRTKNGDPME FLTFEDETDI FEATFFPKTY       960
     TRFCHMIDRG SPFLLWGTVE TNWGAVTLTV EKIEGLPDYN NRL                        1003
//

If you have problems or comments...

PBIL Back to PBIL home page