(data stored in ACNUC7421 zone)

EMBL: CP000859.PE242

CP000859.PE242       Location/Qualifiers
FT   CDS             complement(270853..271938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS34"
FT                   /protein_id="ABW66052.1"
FT                   /translation="MNLFKCYTSHSKKEIKTILEVPFPVLWNDNKERRRSDVTVFDESQ
FT                   HPLLIFEVKMEDELSEDQLDDYIKYALAMNAGFILITKYPAEDWICKTLKTKMSRQYDI
FT                   VTINDLYKNLRRLKSKGLFQQEFIKYLEESCMIYNQILPQEVGLFLQSLFLRTSQQNRA
FT                   TTEKITRGIPYALEIINSNLEFLGNSVREKIEVRYKKRMVVSVLNVFEPFVTKETLEKL
FT                   LKVATKDEDHEVRVKKYSNEIYGYYWFFCSLQLNDNIKYVGLEFGYVATVEKGISRRDV
FT                   VFKNYVQLNPDPDGASYLESPHPLKYKQNKGWDAGDEIKAFDWFYKSIKVAAERYLKHY
FT                   KMNKNQKFKIACKKVEMLLDD"
     MNLFKCYTSH SKKEIKTILE VPFPVLWNDN KERRRSDVTV FDESQHPLLI FEVKMEDELS        60
     EDQLDDYIKY ALAMNAGFIL ITKYPAEDWI CKTLKTKMSR QYDIVTINDL YKNLRRLKSK       120
     GLFQQEFIKY LEESCMIYNQ ILPQEVGLFL QSLFLRTSQQ NRATTEKITR GIPYALEIIN       180
     SNLEFLGNSV REKIEVRYKK RMVVSVLNVF EPFVTKETLE KLLKVATKDE DHEVRVKKYS       240
     NEIYGYYWFF CSLQLNDNIK YVGLEFGYVA TVEKGISRRD VVFKNYVQLN PDPDGASYLE       300
     SPHPLKYKQN KGWDAGDEIK AFDWFYKSIK VAAERYLKHY KMNKNQKFKI ACKKVEMLLD       360
     D                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page