(data stored in ACNUC7421 zone)

EMBL: CP000859.PE244

CP000859.PE244       Location/Qualifiers
FT   CDS             complement(273252..274013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0244"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   dno:DNO_0219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66054"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS36"
FT                   /protein_id="ABW66054.1"
FT                   /translation="MNENIRIGNISIAVTRKKIKNVHLSVHPPNGRVTMSIPVGTRLDV
FT                   ARAYAISKLAWIRDKQEKLAGQARETPRKFIERESHYLWGRRHLLAVVERSAKPSVSVD
FT                   HKRITLFVRPGSDQAKRASVIHEWHKSLLHETVPRLIGKWESRLGVKVNAYFLQRMKTK
FT                   WGSCNCTKRHIRLNTELVKKPKDLVEYVVVHEMAHLIEPSHSDRFYALLEKHYPFWREA
FT                   RAELNELPLTAEEWKSDYTSKVNPVIRRIYR"
     MNENIRIGNI SIAVTRKKIK NVHLSVHPPN GRVTMSIPVG TRLDVARAYA ISKLAWIRDK        60
     QEKLAGQARE TPRKFIERES HYLWGRRHLL AVVERSAKPS VSVDHKRITL FVRPGSDQAK       120
     RASVIHEWHK SLLHETVPRL IGKWESRLGV KVNAYFLQRM KTKWGSCNCT KRHIRLNTEL       180
     VKKPKDLVEY VVVHEMAHLI EPSHSDRFYA LLEKHYPFWR EARAELNELP LTAEEWKSDY       240
     TSKVNPVIRR IYR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page