(data stored in ACNUC7421 zone)

EMBL: CP000859.PE245

CP000859.PE245       Location/Qualifiers
FT   CDS             complement(274010..277126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0245"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: dno:DNO_0220 type I site-specific
FT                   deoxyribonuclease; TIGRFAM: type I site-specific
FT                   deoxyribonuclease, HsdR family; PFAM: type III restriction
FT                   protein res subunit; protein of unknown function DUF450;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66055"
FT                   /db_xref="GOA:A8ZS37"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS37"
FT                   /protein_id="ABW66055.1"
FT                   /translation="MPEKPRPERITQNRVIALFTDKSRPDCLGYQYLGDWSKRDNNRPV
FT                   EAEYLRANLKKRGYSDAHISAALLQLEIAAGTTGVTLYQANLRTYNLLRYPVKVLLAPG
FT                   QPHEDVHLIDWEHPENNDFALAEEVTLKGGYERRPDLVLYINGMAIGVIELKRSSVEVA
FT                   DGVRQLITNQEKIFNEGFFSTVQLVFAGSDSQGLRYGTTGTPEQFFVQWKDEEGDSALA
FT                   PGTLLDKPLAQMCNKKRLLDLIRNCIIFDAGQKKVPRPHQYFGFKAAQERIRRREGGVI
FT                   WHTQGSGKSILMVLIAKWLMEHDPDARILVITDRDELDKQIVDVMRNAGVVGEDAPSPR
FT                   ITSRAQFVEKIGATTPRLLCALIHKFETTDLKGNPPPIHGRFYIFVDECHRTQGGDMNR
FT                   QMKRWMQDAIFIGFTGTPLLRRDKLMTRDVFGTYIHTYKFHQGVADKVILDLKYEARNV
FT                   PQRLTSQKAIDAWFEQKTKNLNNFQKAIVRKTWATMEKLMSAGERKQRIIADIIQDFSL
FT                   KPRLNNDRGTAILVTASIYDACHYFRLFQNTGFGAYCGIITSYEPNANAISKEPANSNE
FT                   RYKFDTYKQCVLDAFTTTEKYEAETRRRFIEEPANCKLLIVVSKLLTGFDAPSCTYIYL
FT                   DNEMHDHTLFQAICRTNRLDGDDKEYGHIVDFKELFGDVQQAIAVYNSDELDIDEGGGG
FT                   ENNIHLKDWLKEGKKKLDDTREALKYLCAPVPEPREMEQYLFYFCGNADNPNALTDTEA
FT                   LRVSFYKSVATFVRAFAAVSQYLAEAGYSAAEIATLNNEVKFFSDTRAAIKKHSGEELD
FT                   IKPYEADMRHLLNTYIQADPADPLGEMDRYSLVELIIKTGIHDAIAKKLNEKGKLSKTA
FT                   VAEGIIHNIRKTIIREQLADPRFYEEMSKLLDDLIKQRQDDTKSYEEFLKQAEALVKKM
FT                   SKGQPGKNIPQELHGRPEATVIYNNLPDILMHLASEDMVQDPVTGFGATRLGLALEIDR
FT                   AMREHAPAGWKGDDTREKQVLNALFPLLKRNRKATMAAFELIKNMSGYA"
     MPEKPRPERI TQNRVIALFT DKSRPDCLGY QYLGDWSKRD NNRPVEAEYL RANLKKRGYS        60
     DAHISAALLQ LEIAAGTTGV TLYQANLRTY NLLRYPVKVL LAPGQPHEDV HLIDWEHPEN       120
     NDFALAEEVT LKGGYERRPD LVLYINGMAI GVIELKRSSV EVADGVRQLI TNQEKIFNEG       180
     FFSTVQLVFA GSDSQGLRYG TTGTPEQFFV QWKDEEGDSA LAPGTLLDKP LAQMCNKKRL       240
     LDLIRNCIIF DAGQKKVPRP HQYFGFKAAQ ERIRRREGGV IWHTQGSGKS ILMVLIAKWL       300
     MEHDPDARIL VITDRDELDK QIVDVMRNAG VVGEDAPSPR ITSRAQFVEK IGATTPRLLC       360
     ALIHKFETTD LKGNPPPIHG RFYIFVDECH RTQGGDMNRQ MKRWMQDAIF IGFTGTPLLR       420
     RDKLMTRDVF GTYIHTYKFH QGVADKVILD LKYEARNVPQ RLTSQKAIDA WFEQKTKNLN       480
     NFQKAIVRKT WATMEKLMSA GERKQRIIAD IIQDFSLKPR LNNDRGTAIL VTASIYDACH       540
     YFRLFQNTGF GAYCGIITSY EPNANAISKE PANSNERYKF DTYKQCVLDA FTTTEKYEAE       600
     TRRRFIEEPA NCKLLIVVSK LLTGFDAPSC TYIYLDNEMH DHTLFQAICR TNRLDGDDKE       660
     YGHIVDFKEL FGDVQQAIAV YNSDELDIDE GGGGENNIHL KDWLKEGKKK LDDTREALKY       720
     LCAPVPEPRE MEQYLFYFCG NADNPNALTD TEALRVSFYK SVATFVRAFA AVSQYLAEAG       780
     YSAAEIATLN NEVKFFSDTR AAIKKHSGEE LDIKPYEADM RHLLNTYIQA DPADPLGEMD       840
     RYSLVELIIK TGIHDAIAKK LNEKGKLSKT AVAEGIIHNI RKTIIREQLA DPRFYEEMSK       900
     LLDDLIKQRQ DDTKSYEEFL KQAEALVKKM SKGQPGKNIP QELHGRPEAT VIYNNLPDIL       960
     MHLASEDMVQ DPVTGFGATR LGLALEIDRA MREHAPAGWK GDDTREKQVL NALFPLLKRN      1020
     RKATMAAFEL IKNMSGYA                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page