(data stored in ACNUC7421 zone)

EMBL: CP000859.PE246

CP000859.PE246       Location/Qualifiers
FT   CDS             complement(277119..279092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0246"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   tfu:Tfu_0065 similar to uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66056"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS38"
FT                   /protein_id="ABW66056.1"
FT                   /translation="MKISTILDHIDSGHMALPEFQRGYVWNRDQVRALFDSLYRRHPVG
FT                   GLLVWATESRSATHRGDGPLAAGVVKLLLDGQQRMTTLYGVARGKPPKFFDGNLQVFTG
FT                   LRFHLESEIFEFYQPVKMKDDSLWIDVTGLMKNGSAGLGKFIATLSTNPELAPKIGDFA
FT                   GRLSQLLGILEIELHAEEVTGADKPLDVVVDIFNRVNSGGTKLSKGDLALAKICAEWPA
FT                   GRDVMRATLKKWADADYNFNLDWLLRSVNTVLTGEAKFLYLHEKSADEIKDALSRATRH
FT                   IDTCLNLISGRLGLDHDQVFFGRFGVPVMARYLDQRECNKLGSMNEKERDKLLFWFAQA
FT                   AMWGRFSGSTESFIDKDLEAIADGDGNLDPLLEQLRLWNGGLRVEAGHFTGWSLGARFY
FT                   PVLYLLTRMGGSRDWGTGLPLKANLLGKMNRLEVHHIFPKARLYKAKALDFRKPEVNAL
FT                   ANFCFLTKDSNLKISDRLPEEYFPEIEAAHPGALASQWIPDDPVLWTLDRYRDFLVARQ
FT                   KLLAAELNHQMETLLHGDTQWLSSGVSPKLEPAIVVGGISSENEEAELDKLNAWIESLG
FT                   LPSGVMSYDYADAQSGRQIAVFDLAWPLGLQEELSQPVAVLLNEEPATIALASQAGFRC
FT                   FTDGQAFRKYVEREMMAGDAHA"
     MKISTILDHI DSGHMALPEF QRGYVWNRDQ VRALFDSLYR RHPVGGLLVW ATESRSATHR        60
     GDGPLAAGVV KLLLDGQQRM TTLYGVARGK PPKFFDGNLQ VFTGLRFHLE SEIFEFYQPV       120
     KMKDDSLWID VTGLMKNGSA GLGKFIATLS TNPELAPKIG DFAGRLSQLL GILEIELHAE       180
     EVTGADKPLD VVVDIFNRVN SGGTKLSKGD LALAKICAEW PAGRDVMRAT LKKWADADYN       240
     FNLDWLLRSV NTVLTGEAKF LYLHEKSADE IKDALSRATR HIDTCLNLIS GRLGLDHDQV       300
     FFGRFGVPVM ARYLDQRECN KLGSMNEKER DKLLFWFAQA AMWGRFSGST ESFIDKDLEA       360
     IADGDGNLDP LLEQLRLWNG GLRVEAGHFT GWSLGARFYP VLYLLTRMGG SRDWGTGLPL       420
     KANLLGKMNR LEVHHIFPKA RLYKAKALDF RKPEVNALAN FCFLTKDSNL KISDRLPEEY       480
     FPEIEAAHPG ALASQWIPDD PVLWTLDRYR DFLVARQKLL AAELNHQMET LLHGDTQWLS       540
     SGVSPKLEPA IVVGGISSEN EEAELDKLNA WIESLGLPSG VMSYDYADAQ SGRQIAVFDL       600
     AWPLGLQEEL SQPVAVLLNE EPATIALASQ AGFRCFTDGQ AFRKYVEREM MAGDAHA          657
//

If you have problems or comments...

PBIL Back to PBIL home page