(data stored in ACNUC7421 zone)

EMBL: CP000859.PE248

CP000859.PE248       Location/Qualifiers
FT   CDS             complement(281606..283453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0248"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   sbm:Shew185_2195 protein of unknown function DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66058"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS40"
FT                   /protein_id="ABW66058.1"
FT                   /translation="MSEFIYTVEEIFDSSTMKGCLTQHGCSAFRIPSYQRGYKWGSETN
FT                   QPVERLLSDLIKAWKAGAKEYLLQAITVKKNSSGNKNYFLEVIDGQQRLTTLFILLYVL
FT                   ERQIEPEVFGKTIAADKLLYSIRHEQQSLDDLIKNCVDTTKEKAIPFEELKEKQRVEEE
FT                   TQQDVYYLKCAFFRCVCELDSISVENNGGHDKLNGLKNFVLTKTKLLVNAVEPHIRGED
FT                   IFCNLNSNRVFLTETELIKGLLLTRVARESATARPRQYREILEKRIHLGRKWDEISRWA
FT                   NQPNIRSLYFTAFKNSGDDHMHDILELVALQMKNSYEQTSKGSVAENPLFEYFLEQGEQ
FT                   GRWEPIFLLLNNTYATLDEWYECTEDYHLLGYCLVEKNETEQKVLLKDLLGKSTKVEVR
FT                   KCLLEQRNEIIKSDSEKQILAYGEDNQRIKSILLALSVFRGREIGGRFDFFAYQHEDWS
FT                   LEHIFPQTPFGKEAKLTHEQEKTAFDVLINNEGNILSEEERKNIEIARASQENAETMMA
FT                   KVNEILIKVPLLHQLGNLCLLSRKDNTAMGCLMFDDKRKVIRDRIARGSFVPSHTYEVF
FT                   SKMIVGKDTSLQVWSKSDIESHQKEIVKRVKELIEEKSS"
     MSEFIYTVEE IFDSSTMKGC LTQHGCSAFR IPSYQRGYKW GSETNQPVER LLSDLIKAWK        60
     AGAKEYLLQA ITVKKNSSGN KNYFLEVIDG QQRLTTLFIL LYVLERQIEP EVFGKTIAAD       120
     KLLYSIRHEQ QSLDDLIKNC VDTTKEKAIP FEELKEKQRV EEETQQDVYY LKCAFFRCVC       180
     ELDSISVENN GGHDKLNGLK NFVLTKTKLL VNAVEPHIRG EDIFCNLNSN RVFLTETELI       240
     KGLLLTRVAR ESATARPRQY REILEKRIHL GRKWDEISRW ANQPNIRSLY FTAFKNSGDD       300
     HMHDILELVA LQMKNSYEQT SKGSVAENPL FEYFLEQGEQ GRWEPIFLLL NNTYATLDEW       360
     YECTEDYHLL GYCLVEKNET EQKVLLKDLL GKSTKVEVRK CLLEQRNEII KSDSEKQILA       420
     YGEDNQRIKS ILLALSVFRG REIGGRFDFF AYQHEDWSLE HIFPQTPFGK EAKLTHEQEK       480
     TAFDVLINNE GNILSEEERK NIEIARASQE NAETMMAKVN EILIKVPLLH QLGNLCLLSR       540
     KDNTAMGCLM FDDKRKVIRD RIARGSFVPS HTYEVFSKMI VGKDTSLQVW SKSDIESHQK       600
     EIVKRVKELI EEKSS                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page