(data stored in ACNUC7421 zone)

EMBL: CP000859.PE252

CP000859.PE252       Location/Qualifiers
FT   CDS             288729..289730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66062"
FT                   /db_xref="InterPro:IPR029470"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS44"
FT                   /protein_id="ABW66062.1"
FT                   /translation="MHPNLFHFATSELSQDAVLCWLLSWAENNHRQHYPHLHKVAKNLL
FT                   DSIYQRSGAKAPAAFSSIEIRKQDGGIDILCIINHEMAILIEDKAGMKQHSDQLARYKE
FT                   YVFKKLGFAADKVIQVYIQTGDQSDYSEVEKHGYQVLRRLDLLDIFEDEAGLAARSQSD
FT                   IFRDFSDYLRQEENEVQSYLVSPPSQWSWNAWKGFYAEVQQQLQDGNWDYVPNPAGGFL
FT                   GFWWHFVGTDEYEIYLQLEQENLCFKIFVENAEKRRHLRQHWYEKIILKCSEHGLKARR
FT                   PGRFGNGRYMTVAIMDQDYRAVDDKGIIKMAETLKTLKAAQSVMDGCMMGKR"
     MHPNLFHFAT SELSQDAVLC WLLSWAENNH RQHYPHLHKV AKNLLDSIYQ RSGAKAPAAF        60
     SSIEIRKQDG GIDILCIINH EMAILIEDKA GMKQHSDQLA RYKEYVFKKL GFAADKVIQV       120
     YIQTGDQSDY SEVEKHGYQV LRRLDLLDIF EDEAGLAARS QSDIFRDFSD YLRQEENEVQ       180
     SYLVSPPSQW SWNAWKGFYA EVQQQLQDGN WDYVPNPAGG FLGFWWHFVG TDEYEIYLQL       240
     EQENLCFKIF VENAEKRRHL RQHWYEKIIL KCSEHGLKAR RPGRFGNGRY MTVAIMDQDY       300
     RAVDDKGIIK MAETLKTLKA AQSVMDGCMM GKR                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page