(data stored in ACNUC7421 zone)

EMBL: CP000859.PE254

CP000859.PE254       Location/Qualifiers
FT   CDS             290333..290890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66064"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS46"
FT                   /protein_id="ABW66064.1"
FT                   /translation="MNARLIINNREVLLGHRHLEEFVFTLDDDPAMREIFHELAKSPSS
FT                   EIRKDISGNQYLSEETRRLLIADTSLEVMRAIILSDEAQALMTQSDLERYLATGDAEIL
FT                   RALAINLKELARKYKVCDLNWLCENLIRHPDPATRYNLAANIYTPAAFLKKLAGDDDVD
FT                   VARKAAETLREVGNGFDPDDDE"
     MNARLIINNR EVLLGHRHLE EFVFTLDDDP AMREIFHELA KSPSSEIRKD ISGNQYLSEE        60
     TRRLLIADTS LEVMRAIILS DEAQALMTQS DLERYLATGD AEILRALAIN LKELARKYKV       120
     CDLNWLCENL IRHPDPATRY NLAANIYTPA AFLKKLAGDD DVDVARKAAE TLREVGNGFD       180
     PDDDE                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page