(data stored in ACNUC7421 zone)

EMBL: CP000859.PE262

CP000859.PE262       Location/Qualifiers
FT   CDS             299412..300380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66072"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS54"
FT                   /protein_id="ABW66072.1"
FT                   /translation="MTTTRTISRCDFLLNALAACAGTVLPLSLSAPSPTDSLAPSPRPI
FT                   EIKRLAPMTHPDDSFKTTVFCMGRPGLYAVSRMVHRFGHIDRNVDYLFVDTHDTEDTNL
FT                   YLPEATRTLLTDLLAESHLALIVADTERGIPEALRTQFAEWRRQSSNMTVTFCLAPAAP
FT                   ANARQPVWTRQPNDVIVNVPATPADTTALMPYAIFGLCHPVYYPGLVGLDLDDIKTVLS
FT                   RTGGIRFGMATAVGENRPATAMRKALKQVYAGIPPSAVQTGLLAFITTNDEDDLSFEDL
FT                   TEAADLLHEALRPFDNAEYTWAHRVTPSVKKGEVLVTVYAG"
     MTTTRTISRC DFLLNALAAC AGTVLPLSLS APSPTDSLAP SPRPIEIKRL APMTHPDDSF        60
     KTTVFCMGRP GLYAVSRMVH RFGHIDRNVD YLFVDTHDTE DTNLYLPEAT RTLLTDLLAE       120
     SHLALIVADT ERGIPEALRT QFAEWRRQSS NMTVTFCLAP AAPANARQPV WTRQPNDVIV       180
     NVPATPADTT ALMPYAIFGL CHPVYYPGLV GLDLDDIKTV LSRTGGIRFG MATAVGENRP       240
     ATAMRKALKQ VYAGIPPSAV QTGLLAFITT NDEDDLSFED LTEAADLLHE ALRPFDNAEY       300
     TWAHRVTPSV KKGEVLVTVY AG                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page