(data stored in ACNUC7421 zone)

EMBL: CP000859.PE263

CP000859.PE263       Location/Qualifiers
FT   CDS             complement(300384..300938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0263"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sde:Sde_1224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66073"
FT                   /db_xref="GOA:A8ZS55"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS55"
FT                   /protein_id="ABW66073.1"
FT                   /translation="MAKLTLHSNSIVLRGRMIRIAKKDDLEGIMAIFKSWPKSYDYESA
FT                   QSYYKNFFDGKHDADVVFVLEKEGEIVGTAGYCLEQSEGVKGIYWLNWLYTSQHHKCKG
FT                   YASTLLDFVIEQLKKKNARKLFVNTSSHKFYKNAIRLYVKFGFEEEGCLEKFYSESEHQ
FT                   IIFGLDFKMIQKIPFDSSLSA"
     MAKLTLHSNS IVLRGRMIRI AKKDDLEGIM AIFKSWPKSY DYESAQSYYK NFFDGKHDAD        60
     VVFVLEKEGE IVGTAGYCLE QSEGVKGIYW LNWLYTSQHH KCKGYASTLL DFVIEQLKKK       120
     NARKLFVNTS SHKFYKNAIR LYVKFGFEEE GCLEKFYSES EHQIIFGLDF KMIQKIPFDS       180
     SLSA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page