(data stored in ACNUC7421 zone)

EMBL: CP000859.PE268

CP000859.PE268       Location/Qualifiers
FT   CDS             306709..308604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0268"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: sfu:Sfum_0160 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66078"
FT                   /db_xref="GOA:A8ZS60"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS60"
FT                   /protein_id="ABW66078.1"
FT                   /translation="MLQFMRQKASSIIIKGVLSLVILAFIFLGIGNFREQQEVTAATVN
FT                   EEIVTGREFQYTYQRLLDTYRQQFGGALNDDLLKMLNLKEQAMNQLISEKIILQQADKL
FT                   GLNVSDSELAATISSIPAFQNNGRFDKTRYNRLLQSNRMTAAAFEQSQKQGLLVDKLRT
FT                   LITDSVLVSDNEARQWFDWENARVKITAAVFAAEGRTDVDPAEAAVAAYYEEHKDQYKT
FT                   PEKRKITYVRVAPARYLSEVKVTEEEIADFYQANQDFYWNEETVEARHILISLEQDADE
FT                   ARVEEARQKAADIYVMVTDGGKDFAETARQYSEGPSAGEGGYLGAFTREDMVAPFSEKA
FT                   FSMAPGEISEPVRSQFGWHIIKVEKVNAAFTTPLDEVRADIEKQLLDQKAGEYAYEEAL
FT                   TLFDMALDTDSVEQAAASRNLTAVTTDAITQNDTLADVEAGRTMVRQAFDFVEKEISDV
FT                   ITEGNTHFLFQVTEVMPAAVPPLENVQARVIEDLREQMRKEAAQAEAESVLEKVKAGQP
FT                   LEAACAGTQAEIVATGFFGRTGAVPDIGNEPALSRAAFDLTKNQPVAPNVVEGRTGYYV
FT                   VVLNDQKAPEASEFEEKRDAVVKRLTAQKKNEVFMSWLKTMRQESDITIDEAFLR"
     MLQFMRQKAS SIIIKGVLSL VILAFIFLGI GNFREQQEVT AATVNEEIVT GREFQYTYQR        60
     LLDTYRQQFG GALNDDLLKM LNLKEQAMNQ LISEKIILQQ ADKLGLNVSD SELAATISSI       120
     PAFQNNGRFD KTRYNRLLQS NRMTAAAFEQ SQKQGLLVDK LRTLITDSVL VSDNEARQWF       180
     DWENARVKIT AAVFAAEGRT DVDPAEAAVA AYYEEHKDQY KTPEKRKITY VRVAPARYLS       240
     EVKVTEEEIA DFYQANQDFY WNEETVEARH ILISLEQDAD EARVEEARQK AADIYVMVTD       300
     GGKDFAETAR QYSEGPSAGE GGYLGAFTRE DMVAPFSEKA FSMAPGEISE PVRSQFGWHI       360
     IKVEKVNAAF TTPLDEVRAD IEKQLLDQKA GEYAYEEALT LFDMALDTDS VEQAAASRNL       420
     TAVTTDAITQ NDTLADVEAG RTMVRQAFDF VEKEISDVIT EGNTHFLFQV TEVMPAAVPP       480
     LENVQARVIE DLREQMRKEA AQAEAESVLE KVKAGQPLEA ACAGTQAEIV ATGFFGRTGA       540
     VPDIGNEPAL SRAAFDLTKN QPVAPNVVEG RTGYYVVVLN DQKAPEASEF EEKRDAVVKR       600
     LTAQKKNEVF MSWLKTMRQE SDITIDEAFL R                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page