(data stored in ACNUC7421 zone)

EMBL: CP000859.PE27

CP000859.PE27        Location/Qualifiers
FT   CDS             28802..29572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU1874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65837"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS0"
FT                   /protein_id="ABW65837.1"
FT                   /translation="MKKLWIGLALALLLAVPATSFAIGLEAAIGGWGQDISGDMAYKPL
FT                   NPITDVIDFERDLGYDSETRVMGRVRIDMPLIIPNIYVMATPMEFEGTSQQAVEFKFGN
FT                   DTFEADIPYTSKLSMNHVDVALFYSIPLLEMATFNRLNIDLGINLKVADLSAEITQPDT
FT                   GLSEKEDYVLPIPMAFAAVQLKPIDLLAIEAEGRGISYSGNHLFNVIGRVKVKPFGPFF
FT                   IAGGYRYDSIKLDEKDLRLDAQVDGFFAETGFEF"
     MKKLWIGLAL ALLLAVPATS FAIGLEAAIG GWGQDISGDM AYKPLNPITD VIDFERDLGY        60
     DSETRVMGRV RIDMPLIIPN IYVMATPMEF EGTSQQAVEF KFGNDTFEAD IPYTSKLSMN       120
     HVDVALFYSI PLLEMATFNR LNIDLGINLK VADLSAEITQ PDTGLSEKED YVLPIPMAFA       180
     AVQLKPIDLL AIEAEGRGIS YSGNHLFNVI GRVKVKPFGP FFIAGGYRYD SIKLDEKDLR       240
     LDAQVDGFFA ETGFEF                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page