(data stored in ACNUC7421 zone)

EMBL: CP000859.PE274

CP000859.PE274       Location/Qualifiers
FT   CDS             312270..314300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0274"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66084"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS66"
FT                   /protein_id="ABW66084.1"
FT                   /translation="MAYKTRREEPSAIMASPESSVKPDHIKIIKGSTDILLIAPHACIR
FT                   DGKPKDDENTGPITEMVAHQIGCSAIINTHFHKPDSKKYPRGMGKGNLDLNVIADAEMV
FT                   PGYLDAIRAVVEAPGKTTVIWIHGADNANAIEVASEATYDFPGDEIHAFIGYGQGGSRP
FT                   KSGCKNLFTAKPETVERFRDALISNRMNAVLTDKDAVNYRGRRTKGMNQWFLNQEYTLD
FT                   QVESIQLEIRKAGFRDLHHNIEKTAGILIEALSQEALVPVIPEETVADEHLVDIAFNHL
FT                   RGIFAKHIHEAMLQAGRYLVRTFYGTYEKARKKEKIRKQSFAKLEERLNNGTGDVPKKT
FT                   WIYDAVKVAVDDHFFRKESKAFFLTYGKLGHSQKVLLTQVKDTNQKKELVEKAVETPQT
FT                   VKQFRESIQAIKKKKRKSKRKGGHSDWTKPENNVSFCSGCENDCIYCYGRYFAANRNQI
FT                   APNHWSKMKIREHHVTKKRTLHAGLIGFPSTHDILPSNLDATLLVLGKLLRAGNKVLIM
FT                   SKPRLDCIKRLCSACEFFKDTILFRFTIGAMDDDILGFWEPNAPTYEERKECLAYARNQ
FT                   GFQTSVSMEPMLDTENLDALIKALRPLVSDKIWLGTMEYLGWIGTRIKADSKGELERLE
FT                   QGQTPDKLVSIFNRYEDDPMIEWKTVALKIIEAHKQQERKP"
     MAYKTRREEP SAIMASPESS VKPDHIKIIK GSTDILLIAP HACIRDGKPK DDENTGPITE        60
     MVAHQIGCSA IINTHFHKPD SKKYPRGMGK GNLDLNVIAD AEMVPGYLDA IRAVVEAPGK       120
     TTVIWIHGAD NANAIEVASE ATYDFPGDEI HAFIGYGQGG SRPKSGCKNL FTAKPETVER       180
     FRDALISNRM NAVLTDKDAV NYRGRRTKGM NQWFLNQEYT LDQVESIQLE IRKAGFRDLH       240
     HNIEKTAGIL IEALSQEALV PVIPEETVAD EHLVDIAFNH LRGIFAKHIH EAMLQAGRYL       300
     VRTFYGTYEK ARKKEKIRKQ SFAKLEERLN NGTGDVPKKT WIYDAVKVAV DDHFFRKESK       360
     AFFLTYGKLG HSQKVLLTQV KDTNQKKELV EKAVETPQTV KQFRESIQAI KKKKRKSKRK       420
     GGHSDWTKPE NNVSFCSGCE NDCIYCYGRY FAANRNQIAP NHWSKMKIRE HHVTKKRTLH       480
     AGLIGFPSTH DILPSNLDAT LLVLGKLLRA GNKVLIMSKP RLDCIKRLCS ACEFFKDTIL       540
     FRFTIGAMDD DILGFWEPNA PTYEERKECL AYARNQGFQT SVSMEPMLDT ENLDALIKAL       600
     RPLVSDKIWL GTMEYLGWIG TRIKADSKGE LERLEQGQTP DKLVSIFNRY EDDPMIEWKT       660
     VALKIIEAHK QQERKP                                                       676
//

If you have problems or comments...

PBIL Back to PBIL home page