(data stored in ACNUC7421 zone)

EMBL: CP000859.PE275

CP000859.PE275       Location/Qualifiers
FT   CDS             314319..316082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0275"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: fnu:FN1787
FT                   tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66085"
FT                   /db_xref="GOA:A8ZS67"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS67"
FT                   /protein_id="ABW66085.1"
FT                   /translation="MDMNRMTISILLVVSILTFNSAFLCADSKFLDSSKTPEKEMDYKF
FT                   IAPKTTIETGVIMTKDGQNIVARKISEDNNVIVYYLGHIAHGITVDKVLSIANTSGSGL
FT                   IGFSEGDRRDSLNGSGFQAEPKTSITKVENLDDVNFIDGGKFFEKGNYTEAIQAYSLYL
FT                   RYYPKSPTGYSNLGLCYLQKGNFKEALKYHTKAIELDDNRANLYIARSVSYWKMGLNDL
FT                   AFADIEKAIELNPNNKDAYLKKGKFLFNKEEYKNAIKPFLKYLELGGNNWEALSALGWA
FT                   YHKTDNDRDALKYLMIAHQSNEGSYDNNIRMADVYRGLKEYENAIKYYTLALNTDKKDI
FT                   FLYLYRGISYMEKGDYSLAELDFKKALELKENDPVVLCNYAQLYIYQDKDRKAIPLLKK
FT                   VLEVSKDEECNIWSKFTLEEISKSRKKTRNVIALFLIFIALIFLILLGVLKLKKSAGLM
FT                   RVNVTKKLKYISTATVLMCGVMFFILSQQTEKSTERAKAEPAIRQALQAVDLGRYSIAS
FT                   DFYHKAIEFDPDRKEEFDRRINAMMDRRLQELWSGQYDFGKMRRYPEWEAARKADAFVQ
FT                   KEIQKFHRDFK"
     MDMNRMTISI LLVVSILTFN SAFLCADSKF LDSSKTPEKE MDYKFIAPKT TIETGVIMTK        60
     DGQNIVARKI SEDNNVIVYY LGHIAHGITV DKVLSIANTS GSGLIGFSEG DRRDSLNGSG       120
     FQAEPKTSIT KVENLDDVNF IDGGKFFEKG NYTEAIQAYS LYLRYYPKSP TGYSNLGLCY       180
     LQKGNFKEAL KYHTKAIELD DNRANLYIAR SVSYWKMGLN DLAFADIEKA IELNPNNKDA       240
     YLKKGKFLFN KEEYKNAIKP FLKYLELGGN NWEALSALGW AYHKTDNDRD ALKYLMIAHQ       300
     SNEGSYDNNI RMADVYRGLK EYENAIKYYT LALNTDKKDI FLYLYRGISY MEKGDYSLAE       360
     LDFKKALELK ENDPVVLCNY AQLYIYQDKD RKAIPLLKKV LEVSKDEECN IWSKFTLEEI       420
     SKSRKKTRNV IALFLIFIAL IFLILLGVLK LKKSAGLMRV NVTKKLKYIS TATVLMCGVM       480
     FFILSQQTEK STERAKAEPA IRQALQAVDL GRYSIASDFY HKAIEFDPDR KEEFDRRINA       540
     MMDRRLQELW SGQYDFGKMR RYPEWEAARK ADAFVQKEIQ KFHRDFK                     587
//

If you have problems or comments...

PBIL Back to PBIL home page