(data stored in ACNUC7421 zone)

EMBL: CP000859.PE277

CP000859.PE277       Location/Qualifiers
FT   CDS             318150..319391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0277"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: pha:PSHAa2093 type I
FT                   restriction-modification system, S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66087"
FT                   /db_xref="GOA:A8ZS69"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS69"
FT                   /protein_id="ABW66087.1"
FT                   /translation="MKRYPKYKDSGVEWIGEVPEQWEVKRLKFLAKNVNEQTNTKKQDE
FT                   IYIALENVESWTGRISPQDNEITFESQAKCFCSNDILFGKLRPYLAKVARPNKSGVCVG
FT                   EFLVLRVLDNEVLPEFLEQKLRSQWFIELVNSSTFGAKMPRADWTFISNVKLTYPSPKE
FT                   QNHIASYLDHKTRLIDTLIEKKQKLVELLQEQRTALISHAVTKGLNPKTKMKDTGIEWL
FT                   GKVPEHWATASLRWYLRIGSGEFLSNNDFLTEASDQKNIPVIGGNGVMGYTSKTNIQEP
FT                   TIAIGRVGALCGNVHLVNPPAWITDNALRLSNIKDFLIDYLSLFLGVLDLNRLANQNAQ
FT                   PLITGSMIKSQKVPIPPIPEQKDILQYCSKFSQTIDHGINTLHKQIAVLQEYRTTLISD
FT                   VVTGKIDVRDEVIP"
     MKRYPKYKDS GVEWIGEVPE QWEVKRLKFL AKNVNEQTNT KKQDEIYIAL ENVESWTGRI        60
     SPQDNEITFE SQAKCFCSND ILFGKLRPYL AKVARPNKSG VCVGEFLVLR VLDNEVLPEF       120
     LEQKLRSQWF IELVNSSTFG AKMPRADWTF ISNVKLTYPS PKEQNHIASY LDHKTRLIDT       180
     LIEKKQKLVE LLQEQRTALI SHAVTKGLNP KTKMKDTGIE WLGKVPEHWA TASLRWYLRI       240
     GSGEFLSNND FLTEASDQKN IPVIGGNGVM GYTSKTNIQE PTIAIGRVGA LCGNVHLVNP       300
     PAWITDNALR LSNIKDFLID YLSLFLGVLD LNRLANQNAQ PLITGSMIKS QKVPIPPIPE       360
     QKDILQYCSK FSQTIDHGIN TLHKQIAVLQ EYRTTLISDV VTGKIDVRDE VIP              413
//

If you have problems or comments...

PBIL Back to PBIL home page