(data stored in ACNUC7421 zone)

EMBL: CP000859.PE279

CP000859.PE279       Location/Qualifiers
FT   CDS             322487..323608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_0599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66089"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS71"
FT                   /protein_id="ABW66089.1"
FT                   /translation="MGTCTAKDTNPEYWSDYSNLQHVKHKIIQNYLNGWFPKLGRWSGR
FT                   ICYFDTHAGRGRHKGGQEGSPLVALGCILNHKHRESHLSGCEIKMFFIEADDQNCCALQ
FT                   NEINRLGPLPKQVQVHTITENCFDTLQSILEHLNESGNSLAPAFIFVDPYGFKVPGAVL
FT                   RKLMAFDRVELFVNVIWRELSMAIAQGETQPGMANTLNEIFEGEQWHGLVGMAFDEQAN
FT                   ACINLIRKNTGAKWATHIRMLGPNGATRYMLMHLTNHDSGRNLMKDCVWKACPENGYYA
FT                   RAKDDPKQQFLIRPEPDLKPLEDWVIKILSSGPTKWKDLLEQNLSEIWRDTHLNKVIKQ
FT                   CRKSGRIGARNYEGRFALTNNPELFIYKRGFFQ"
     MGTCTAKDTN PEYWSDYSNL QHVKHKIIQN YLNGWFPKLG RWSGRICYFD THAGRGRHKG        60
     GQEGSPLVAL GCILNHKHRE SHLSGCEIKM FFIEADDQNC CALQNEINRL GPLPKQVQVH       120
     TITENCFDTL QSILEHLNES GNSLAPAFIF VDPYGFKVPG AVLRKLMAFD RVELFVNVIW       180
     RELSMAIAQG ETQPGMANTL NEIFEGEQWH GLVGMAFDEQ ANACINLIRK NTGAKWATHI       240
     RMLGPNGATR YMLMHLTNHD SGRNLMKDCV WKACPENGYY ARAKDDPKQQ FLIRPEPDLK       300
     PLEDWVIKIL SSGPTKWKDL LEQNLSEIWR DTHLNKVIKQ CRKSGRIGAR NYEGRFALTN       360
     NPELFIYKRG FFQ                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page