(data stored in ACNUC7421 zone)

EMBL: CP000859.PE28

CP000859.PE28        Location/Qualifiers
FT   CDS             29588..30250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0028"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sfu:Sfum_1732 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65838"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS1"
FT                   /protein_id="ABW65838.1"
FT                   /translation="MQHSDKNPMVVRQIKLSRMETFCYLVGDPASKTGLLIDPAFDTGR
FT                   ILAAAATAGFTITAVVNTHGHADHCCGNAAVMGASGARLHIHKKDARQLTGFFNGVLCR
FT                   LLGGRPSPRPDVVLQHGEAVVLGQTTLTVLHTPGHTPGSICLYMPGHLFAGDTLFVGSA
FT                   GRTDLSGGSIKDLHASIRTRLFPLPDDTRVWPGHDYGDRPVSTIGHEKKTNPFMQAD"
     MQHSDKNPMV VRQIKLSRME TFCYLVGDPA SKTGLLIDPA FDTGRILAAA ATAGFTITAV        60
     VNTHGHADHC CGNAAVMGAS GARLHIHKKD ARQLTGFFNG VLCRLLGGRP SPRPDVVLQH       120
     GEAVVLGQTT LTVLHTPGHT PGSICLYMPG HLFAGDTLFV GSAGRTDLSG GSIKDLHASI       180
     RTRLFPLPDD TRVWPGHDYG DRPVSTIGHE KKTNPFMQAD                             220
//

If you have problems or comments...

PBIL Back to PBIL home page