(data stored in ACNUC7421 zone)

EMBL: CP000859.PE287

CP000859.PE287       Location/Qualifiers
FT   CDS             329447..330964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_1227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66097"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS79"
FT                   /protein_id="ABW66097.1"
FT                   /translation="MKVSSRTRQTKALRAVLLNLINAHHLDRPVRYSRNKNRYTRDRRY
FT                   GQHHYTYDRLIPIIDALERLGYIEQSSYYKDPDDDRYGLQTRMWGTELLWARCRRYRVT
FT                   HYFGLALNPPEEKEVIVLRNKEKQDRPYRETHQTRQMRDDLERYNGFIDRNFISVRLTG
FT                   DSIVDNRWLVENLYQNISKSETWIQSVILNNSHSKYKYTTPIPTFTKHLLPFHTNPYRI
FT                   IQSTRDRIPINNPIPITNTKRGKVLLDVLLQRFWSEAHFFEKDLYKRSIEIGRIPLDKR
FT                   RKVLDVKSPLQDIGVDELVFVLDHEHLRRIFNRESWEYGGRAYGALHQSMLRRPMRKNV
FT                   LIDGEPTVEIDYSAFHIRMLYHREGIDYTDDPYLECEGHEMRDIYKAVGLIAINSTERD
FT                   ACGAIRDELENRGLAPPDREKPYASLVSGFKQTHPAIAHHLFSDVGIRLQNIDSIIMNA
FT                   ILVRLMDNGILGLPVYDSVIVQQQHGTFTREVMTEEYRKQTGFNPKF"
     MKVSSRTRQT KALRAVLLNL INAHHLDRPV RYSRNKNRYT RDRRYGQHHY TYDRLIPIID        60
     ALERLGYIEQ SSYYKDPDDD RYGLQTRMWG TELLWARCRR YRVTHYFGLA LNPPEEKEVI       120
     VLRNKEKQDR PYRETHQTRQ MRDDLERYNG FIDRNFISVR LTGDSIVDNR WLVENLYQNI       180
     SKSETWIQSV ILNNSHSKYK YTTPIPTFTK HLLPFHTNPY RIIQSTRDRI PINNPIPITN       240
     TKRGKVLLDV LLQRFWSEAH FFEKDLYKRS IEIGRIPLDK RRKVLDVKSP LQDIGVDELV       300
     FVLDHEHLRR IFNRESWEYG GRAYGALHQS MLRRPMRKNV LIDGEPTVEI DYSAFHIRML       360
     YHREGIDYTD DPYLECEGHE MRDIYKAVGL IAINSTERDA CGAIRDELEN RGLAPPDREK       420
     PYASLVSGFK QTHPAIAHHL FSDVGIRLQN IDSIIMNAIL VRLMDNGILG LPVYDSVIVQ       480
     QQHGTFTREV MTEEYRKQTG FNPKF                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page