(data stored in ACNUC7421 zone)

EMBL: CP000859.PE289

CP000859.PE289       Location/Qualifiers
FT   CDS             complement(332755..333066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0289"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   sat:SYN_00105 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66099"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZS81"
FT                   /protein_id="ABW66099.1"
FT                   /translation="MIPVKEHAHTLCFPLLVAPRSSKNMVVGAHDNALKIKITAPPVDG
FT                   RANEMCVAFLSRLLGIPKTSITIAAGAASKRKEVCLALSPNAAGKQEAARIKALLAGY"
     MIPVKEHAHT LCFPLLVAPR SSKNMVVGAH DNALKIKITA PPVDGRANEM CVAFLSRLLG        60
     IPKTSITIAA GAASKRKEVC LALSPNAAGK QEAARIKALL AGY                         103
//

If you have problems or comments...

PBIL Back to PBIL home page