(data stored in ACNUC7421 zone)

EMBL: CP000859.PE29

CP000859.PE29        Location/Qualifiers
FT   CDS             complement(30274..30918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0029"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: sat:SYN_01019
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65839"
FT                   /db_xref="GOA:A8ZRS2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS2"
FT                   /protein_id="ABW65839.1"
FT                   /translation="MIKVLVADDHKIIREGLCNMLDAEPDLKVVGAASNGREALALARK
FT                   LSPDVVIMDISMPELNGIEATRQIRAEAPQAAVIALSMYADKRYVLGMLKAGVAGYLIK
FT                   DCAFEELARAVVVVHRGETYLSPAIADTVRKVLVTRIDQDPLTRVEELTERERQVLQMI
FT                   AEGIKTKDIAESLHISVKTVETYRSSIMQKLGLFSVAELTKFAVREGITPP"
     MIKVLVADDH KIIREGLCNM LDAEPDLKVV GAASNGREAL ALARKLSPDV VIMDISMPEL        60
     NGIEATRQIR AEAPQAAVIA LSMYADKRYV LGMLKAGVAG YLIKDCAFEE LARAVVVVHR       120
     GETYLSPAIA DTVRKVLVTR IDQDPLTRVE ELTERERQVL QMIAEGIKTK DIAESLHISV       180
     KTVETYRSSI MQKLGLFSVA ELTKFAVREG ITPP                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page