(data stored in ACNUC7421 zone)

EMBL: CP000859.PE295

CP000859.PE295       Location/Qualifiers
FT   CDS             complement(339512..340543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0295"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tte:TTE0215 Beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66105"
FT                   /db_xref="GOA:A8ZS87"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS87"
FT                   /protein_id="ABW66105.1"
FT                   /translation="MAATDKRPFSLSGFSDDMLAGQRLVAGFEGTTLNDDLKYLIDTLK
FT                   VGGIILFAVNLEHPDQIRDLCASAQAHAAACRLPPLFVAIDQEGGQVARLKPPFTRFEG
FT                   NPSITTDDQARHFARITASELAGIGVNMNMAPVLDVADGVTDSVMAGRAFAGGPREVAR
FT                   LGGVVIEEMQKNGIMAVGKHFPGIGRTTADSHIDQPWLAADPAEMETTDLVPFKTAIER
FT                   DVAGIMLSHIRYTALDPDLPASMSTPIAKTLLREKLGYEGLVMTDDLDMGAIRNHHVMD
FT                   QVVRCADRAGIDMVLVCHKGPDRKKAVESFRELLETSDTHRKQALCSVERILRAKARYL
FT                   CRI"
     MAATDKRPFS LSGFSDDMLA GQRLVAGFEG TTLNDDLKYL IDTLKVGGII LFAVNLEHPD        60
     QIRDLCASAQ AHAAACRLPP LFVAIDQEGG QVARLKPPFT RFEGNPSITT DDQARHFARI       120
     TASELAGIGV NMNMAPVLDV ADGVTDSVMA GRAFAGGPRE VARLGGVVIE EMQKNGIMAV       180
     GKHFPGIGRT TADSHIDQPW LAADPAEMET TDLVPFKTAI ERDVAGIMLS HIRYTALDPD       240
     LPASMSTPIA KTLLREKLGY EGLVMTDDLD MGAIRNHHVM DQVVRCADRA GIDMVLVCHK       300
     GPDRKKAVES FRELLETSDT HRKQALCSVE RILRAKARYL CRI                         343
//

If you have problems or comments...

PBIL Back to PBIL home page