(data stored in ACNUC7421 zone)

EMBL: CP000859.PE297

CP000859.PE297       Location/Qualifiers
FT   CDS             complement(341403..342242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0297"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   bcz:BCZK4981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66107"
FT                   /db_xref="GOA:A8ZS89"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS89"
FT                   /protein_id="ABW66107.1"
FT                   /translation="METAVVNFTYRHKTGKRRFSMEGPNEKDYIINYIDEKKSFYEIDL
FT                   LEYMDFITRHENRSGAVCIDVGANIGNHSVYMGAFIGKKVVSIEPNARLYKALYHNLEN
FT                   NVADYHVIECAVGEQKTEGRLVFPVDSEGSMGLARLESPEDSAPSENRLLKGDTVAVDT
FT                   LDVVVSRHVDNHDRILLIKIDVEGNELSVLKGAVHTLEHHHPHLFVEVCRPELKNDLDR
FT                   YLAERHYLPISRWAGTPVYHYVYRPTRGQSVKASLFRLKYVLITRHIKSIKRRLHWP"
     METAVVNFTY RHKTGKRRFS MEGPNEKDYI INYIDEKKSF YEIDLLEYMD FITRHENRSG        60
     AVCIDVGANI GNHSVYMGAF IGKKVVSIEP NARLYKALYH NLENNVADYH VIECAVGEQK       120
     TEGRLVFPVD SEGSMGLARL ESPEDSAPSE NRLLKGDTVA VDTLDVVVSR HVDNHDRILL       180
     IKIDVEGNEL SVLKGAVHTL EHHHPHLFVE VCRPELKNDL DRYLAERHYL PISRWAGTPV       240
     YHYVYRPTRG QSVKASLFRL KYVLITRHIK SIKRRLHWP                              279
//

If you have problems or comments...

PBIL Back to PBIL home page