(data stored in ACNUC7421 zone)

EMBL: CP000859.PE3

CP000859.PE3         Location/Qualifiers
FT   CDS             complement(3019..3234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65813"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP6"
FT                   /protein_id="ABW65813.1"
FT                   /translation="MRDFIGMDDIWDRLFRQDEMGCLGDFNPNSRLCTRKCALAVRCII
FT                   VYNHRIETMEVDDLFGFQDSDTAPIQ"
     MRDFIGMDDI WDRLFRQDEM GCLGDFNPNS RLCTRKCALA VRCIIVYNHR IETMEVDDLF        60
     GFQDSDTAPI Q                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page