(data stored in ACNUC7421 zone)

EMBL: CP000859.PE30

CP000859.PE30        Location/Qualifiers
FT   CDS             complement(30896..36115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0030"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; SMART: serine/threonine protein
FT                   kinase; KEGG: pth:PTH_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65840"
FT                   /db_xref="GOA:A8ZRS3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS3"
FT                   /protein_id="ABW65840.1"
FT                   /translation="MAHPLGDIARQALAHRYDRLVEMDATGTSTTLSAVDRDTGRAVVA
FT                   RLLGVETRFPAAGTLLDHVARLASLSSDYLLEIYEYREVPADSPSGILVIHEAFTGMPL
FT                   GDLLPSFHRMLSEDARPGHAFCVLAAQMATALRDLHAAGLLYRGITPHSFLFNPATRRF
FT                   KLDGLAWDDAWLPEQGGFSAGVAASALSCLAPEQAGRMDHVVDFRANLYSLGVLFYEMM
FT                   TGKHPFPAGDAAGVLYGHTARTPALPSDLNPAMDTALSRMVLKLLAKHPDDRYQSAAGL
FT                   LFDLADLTGRFDAALSVGEFMPGRKDVSPVFALPDRLYGREEALSFLKKRFDRVRAGDT
FT                   GVVMVTGGTGVGKTEVIRHLSRYVRESGGIFLTGKFDPNQQNVPLSASKTAIASIARWL
FT                   LSRPPDQIRAWREKILSAVWPSGQVLVDMIPEMELIIGKQPPLGELPPMEANMRMALVM
FT                   EKFGTLFLAREHPVVFFLDDLQWADRGTLEHGVAFMLIRQRHYCMVLGTCRDSEVDDTH
FT                   PLSRFLEKLERTSVPVEKLSLRPLDIDQTTAMMADTLSQARTAVLPLARIVFEKTGGNP
FT                   FFIRQFLGSLHANGLIHYDTGRGCWAWNVERIAAADITDNVARLLSTTIDKLPAPTLSV
FT                   LQAAACAGNRIDPELLVLVIGRDRADICAHVQTALEAGLVHPVTDPSATAPAVDTSTGL
FT                   TWEFAHDHILQAVYQTLPETQAREIHWTVGKALLEKASEGAPGERIFDIVHQLRLGMPL
FT                   SLSSPEATELARLNLEAGRVAMETISFEGAADYLRHACNLLPDTAWETHYDLAAGIYGA
FT                   LARCEFALGAFVESERLFGLLLQKAPSLVTRARAYNAMVELHTAAGNIDKALMLGRRAL
FT                   ETLGIHLPRRPGRARVLLLLVRLRLIWGVRRVSAILDAAENRDETLDITLTLLTNIGLP
FT                   TFYVNPLLCLWINATGILLGIRNPKEGFPLQHASFGLITLGAFLGSIFGFIGMGRHYAK
FT                   TGMRLLERQAPGQYQAIAYFVSAFFNRHWYQPARKSIDSFKRAYRHALKTGDISYAGHS
FT                   INSMFMVRFFLGDNLDAVYAYHQRHEAFIQKARSPFAVAHYKLLRQLYRSLKGQALSPA
FT                   GLDTKDYDTAAEFAAVVDTGNLLLRFFFLLSQLKLYVFHRQWENGASLVERIQAMNYLP
FT                   VGTLVVTEYCFFAFLSITNLIVAGTPPQQARRYSRRAARFIRRMRQWYRLQPDNFEPML
FT                   RLMEAEKARVQGRPVQAQERYRQAVAAARDGGFTHLAALGCESAGNFFAAQGDTVAARA
FT                   YLAEARKAYLDWGATAKAADLEKQHAGLFAAIPGHTAVSISPLERADHGAVVAALQAVS
FT                   QEIVVRRLLTRLMEITMAATGASRAAFISNRQGRLFVEVERWGNETDQTLLKSEPLLEQ
FT                   PTSLMAAVVYYVKRTRELVVMNDVKKESSLFQKNSDDAGTPRALVCMPMARNKRLVGIL
FT                   YLENALTGGVFTEDRIGLLTMIASQAAVSFENATLYEHVMKNEQDLKRLSEKLRSLYSE
FT                   LLLTEERERRRIATELHDRIGHALAGAKIGLETLCKGSAKEHEARLRDVLAVLDQSIAD
FT                   TRTLTFELSPPILYHLGLGPALDWLCEETQKKHGLTVSFADTGQEGGLDQKTEILCFQI
FT                   VRELLFNAVKHSQAGHVEVRLYRNGARMGLTIQDDGVGFDGSRQSAGSGFGLFSIHERL
FT                   RLVGGEMNIDTGKNRGTTIDITVPLTGENQNQGEVNDQGSGG"
     MAHPLGDIAR QALAHRYDRL VEMDATGTST TLSAVDRDTG RAVVARLLGV ETRFPAAGTL        60
     LDHVARLASL SSDYLLEIYE YREVPADSPS GILVIHEAFT GMPLGDLLPS FHRMLSEDAR       120
     PGHAFCVLAA QMATALRDLH AAGLLYRGIT PHSFLFNPAT RRFKLDGLAW DDAWLPEQGG       180
     FSAGVAASAL SCLAPEQAGR MDHVVDFRAN LYSLGVLFYE MMTGKHPFPA GDAAGVLYGH       240
     TARTPALPSD LNPAMDTALS RMVLKLLAKH PDDRYQSAAG LLFDLADLTG RFDAALSVGE       300
     FMPGRKDVSP VFALPDRLYG REEALSFLKK RFDRVRAGDT GVVMVTGGTG VGKTEVIRHL       360
     SRYVRESGGI FLTGKFDPNQ QNVPLSASKT AIASIARWLL SRPPDQIRAW REKILSAVWP       420
     SGQVLVDMIP EMELIIGKQP PLGELPPMEA NMRMALVMEK FGTLFLAREH PVVFFLDDLQ       480
     WADRGTLEHG VAFMLIRQRH YCMVLGTCRD SEVDDTHPLS RFLEKLERTS VPVEKLSLRP       540
     LDIDQTTAMM ADTLSQARTA VLPLARIVFE KTGGNPFFIR QFLGSLHANG LIHYDTGRGC       600
     WAWNVERIAA ADITDNVARL LSTTIDKLPA PTLSVLQAAA CAGNRIDPEL LVLVIGRDRA       660
     DICAHVQTAL EAGLVHPVTD PSATAPAVDT STGLTWEFAH DHILQAVYQT LPETQAREIH       720
     WTVGKALLEK ASEGAPGERI FDIVHQLRLG MPLSLSSPEA TELARLNLEA GRVAMETISF       780
     EGAADYLRHA CNLLPDTAWE THYDLAAGIY GALARCEFAL GAFVESERLF GLLLQKAPSL       840
     VTRARAYNAM VELHTAAGNI DKALMLGRRA LETLGIHLPR RPGRARVLLL LVRLRLIWGV       900
     RRVSAILDAA ENRDETLDIT LTLLTNIGLP TFYVNPLLCL WINATGILLG IRNPKEGFPL       960
     QHASFGLITL GAFLGSIFGF IGMGRHYAKT GMRLLERQAP GQYQAIAYFV SAFFNRHWYQ      1020
     PARKSIDSFK RAYRHALKTG DISYAGHSIN SMFMVRFFLG DNLDAVYAYH QRHEAFIQKA      1080
     RSPFAVAHYK LLRQLYRSLK GQALSPAGLD TKDYDTAAEF AAVVDTGNLL LRFFFLLSQL      1140
     KLYVFHRQWE NGASLVERIQ AMNYLPVGTL VVTEYCFFAF LSITNLIVAG TPPQQARRYS      1200
     RRAARFIRRM RQWYRLQPDN FEPMLRLMEA EKARVQGRPV QAQERYRQAV AAARDGGFTH      1260
     LAALGCESAG NFFAAQGDTV AARAYLAEAR KAYLDWGATA KAADLEKQHA GLFAAIPGHT      1320
     AVSISPLERA DHGAVVAALQ AVSQEIVVRR LLTRLMEITM AATGASRAAF ISNRQGRLFV      1380
     EVERWGNETD QTLLKSEPLL EQPTSLMAAV VYYVKRTREL VVMNDVKKES SLFQKNSDDA      1440
     GTPRALVCMP MARNKRLVGI LYLENALTGG VFTEDRIGLL TMIASQAAVS FENATLYEHV      1500
     MKNEQDLKRL SEKLRSLYSE LLLTEERERR RIATELHDRI GHALAGAKIG LETLCKGSAK      1560
     EHEARLRDVL AVLDQSIADT RTLTFELSPP ILYHLGLGPA LDWLCEETQK KHGLTVSFAD      1620
     TGQEGGLDQK TEILCFQIVR ELLFNAVKHS QAGHVEVRLY RNGARMGLTI QDDGVGFDGS      1680
     RQSAGSGFGL FSIHERLRLV GGEMNIDTGK NRGTTIDITV PLTGENQNQG EVNDQGSGG       1739
//

If you have problems or comments...

PBIL Back to PBIL home page