(data stored in ACNUC7421 zone)

EMBL: CP000859.PE300

CP000859.PE300       Location/Qualifiers
FT   CDS             344402..345388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0300"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="KEGG: dvu:DVU3143 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66110"
FT                   /db_xref="GOA:A8ZS92"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS92"
FT                   /protein_id="ABW66110.1"
FT                   /translation="MPDTISRRNFLKAGLITAGAVAASGTGLASMAGAASGEPLCTLLD
FT                   LSRCIGCEECVYACREVNGHKFPELKGAIPEMIPREKVKIADWSAPEKQAVSDRLTPYN
FT                   WLYIQRAYGEHNGEPFELNIPRRCMHCENPPCSKLCPFGAAYQQDNGIVAISPDICMGG
FT                   AKCKAVCPWHIPERQSGVGLHLNLMPQYAGNGVMYKCDRCFDRVAEGELPACIEVCPVD
FT                   VQQIGPKSRIIEKARQLAKETNGFIYGLEENGGTNTIYVSPVPFDVLNGSVEKGPGKPH
FT                   LQPVADAMTTPNRMFAALAIAPVAGIVAAVARFGLLAGNKDHEKENM"
     MPDTISRRNF LKAGLITAGA VAASGTGLAS MAGAASGEPL CTLLDLSRCI GCEECVYACR        60
     EVNGHKFPEL KGAIPEMIPR EKVKIADWSA PEKQAVSDRL TPYNWLYIQR AYGEHNGEPF       120
     ELNIPRRCMH CENPPCSKLC PFGAAYQQDN GIVAISPDIC MGGAKCKAVC PWHIPERQSG       180
     VGLHLNLMPQ YAGNGVMYKC DRCFDRVAEG ELPACIEVCP VDVQQIGPKS RIIEKARQLA       240
     KETNGFIYGL EENGGTNTIY VSPVPFDVLN GSVEKGPGKP HLQPVADAMT TPNRMFAALA       300
     IAPVAGIVAA VARFGLLAGN KDHEKENM                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page