(data stored in ACNUC7421 zone)

EMBL: CP000859.PE303

CP000859.PE303       Location/Qualifiers
FT   CDS             complement(347399..348076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_3708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66113"
FT                   /db_xref="GOA:A8ZS95"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZS95"
FT                   /protein_id="ABW66113.1"
FT                   /translation="MNTPDTFDVIYNFVSGPLVWAAFILFVGGSIYRLWKMLALVNKKD
FT                   RFIFTYMSLYHSLRSIAHWIVPFGTTSWRMHPVMTVATFAFHICLLVLPIFLAGHVVMI
FT                   AFSWGVSWPTLPAGVVDVMTVIVIACCIFFLVRRIVQKEVKYLTTPSDYVLLLITAAPF
FT                   VTGFFAYHQWLDYRTWILLHILSGEIMLVAIPFTRLSHMLFAVFTRSYIASEFGGVRCA
FT                   KDW"
     MNTPDTFDVI YNFVSGPLVW AAFILFVGGS IYRLWKMLAL VNKKDRFIFT YMSLYHSLRS        60
     IAHWIVPFGT TSWRMHPVMT VATFAFHICL LVLPIFLAGH VVMIAFSWGV SWPTLPAGVV       120
     DVMTVIVIAC CIFFLVRRIV QKEVKYLTTP SDYVLLLITA APFVTGFFAY HQWLDYRTWI       180
     LLHILSGEIM LVAIPFTRLS HMLFAVFTRS YIASEFGGVR CAKDW                       225
//

If you have problems or comments...

PBIL Back to PBIL home page