(data stored in ACNUC7421 zone)

EMBL: CP000859.PE309

CP000859.PE309       Location/Qualifiers
FT   CDS             353467..354090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0309"
FT                   /product="RnfA-Nqr electron transport subunit"
FT                   /note="PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   cpe:CPE1063 probable Na-translocating NADH-quinone
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66119"
FT                   /db_xref="GOA:A8ZSV5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV5"
FT                   /protein_id="ABW66119.1"
FT                   /translation="MSTEPTPMERFLQGIIPENPVYRQLLGLCPVLAVTGNMQSAMTMA
FT                   GAVLFVLFCANVMISLIRNILKPHLRIVIFTLTIATFVTIVDRFLAAYMYNMSKALGPY
FT                   IPLIIVNCIIICRCEVCASKQSVFHAGADAIGQSLGFALALASIATVREILGTGMFFGL
FT                   PVLPDVWPDWVIMALPPGAFFTFGLLLGLVNWFTANRAKKEKNS"
     MSTEPTPMER FLQGIIPENP VYRQLLGLCP VLAVTGNMQS AMTMAGAVLF VLFCANVMIS        60
     LIRNILKPHL RIVIFTLTIA TFVTIVDRFL AAYMYNMSKA LGPYIPLIIV NCIIICRCEV       120
     CASKQSVFHA GADAIGQSLG FALALASIAT VREILGTGMF FGLPVLPDVW PDWVIMALPP       180
     GAFFTFGLLL GLVNWFTANR AKKEKNS                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page