(data stored in ACNUC7421 zone)

EMBL: CP000859.PE310

CP000859.PE310       Location/Qualifiers
FT   CDS             354109..354876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0310"
FT                   /product="RnfA-Nqr electron transport subunit"
FT                   /note="PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   ctc:CTC01023 rnfA/nqrE"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66120"
FT                   /db_xref="GOA:A8ZSV6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV6"
FT                   /protein_id="ABW66120.1"
FT                   /translation="MNYIIDIFLIAMSAALINNFVLYYFVGICPFIGVSRNISMAFGMG
FT                   CAVTFVITIAAFISWAITTFVLIPGAPLTAFVAGFFLPGEQAAAVDLTILSYIVYIFAI
FT                   SSSVQFVEMYVRKFFPPLYKSFGVFLPLITTNCAILFACLTIMSNVAVDNPAEAWDLGR
FT                   ALVLAIFGGVGFTIAIVIMAGIREELDMCDVPKPLQGAAITLVTAGILAMGFMGFTGVD
FT                   SGLKKALKPEPAQEMSINLQDAAPVLARVTIEN"
     MNYIIDIFLI AMSAALINNF VLYYFVGICP FIGVSRNISM AFGMGCAVTF VITIAAFISW        60
     AITTFVLIPG APLTAFVAGF FLPGEQAAAV DLTILSYIVY IFAISSSVQF VEMYVRKFFP       120
     PLYKSFGVFL PLITTNCAIL FACLTIMSNV AVDNPAEAWD LGRALVLAIF GGVGFTIAIV       180
     IMAGIREELD MCDVPKPLQG AAITLVTAGI LAMGFMGFTG VDSGLKKALK PEPAQEMSIN       240
     LQDAAPVLAR VTIEN                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page