(data stored in ACNUC7421 zone)

EMBL: CP000859.PE311

CP000859.PE311       Location/Qualifiers
FT   CDS             354914..355825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0311"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Fe-S cluster domain protein; KEGG:
FT                   cbh:CLC_0431 electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66121"
FT                   /db_xref="GOA:A8ZSV7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSV7"
FT                   /protein_id="ABW66121.1"
FT                   /translation="MSAVTIGLAAGTLVGMAVILTYILGWANVAFYVEVDPRVDAVSKA
FT                   LPGANCGGCGFVGCGEYAEAVVMQGAPVNKCAPGGANCAAAIAQIMGVEVGEALPYRPI
FT                   VHCGAHTKDKHGISDYRGEQRCVTANIVADVQGCTYGCLGFGDCVEACAYDAIHVINGL
FT                   AVVDYTACVGCGACAKACPRNIITMTPFKADRVFAVLCSNKDAGKEVKKVCDVGCLGCK
FT                   ACERACGLFAIKDNLSCINYDDYDPEHLEDIFKAIDKCPQKGIVLVGKPSEKDMAAVAD
FT                   KEAPSVVTPDFKTTVDDTEWRG"
     MSAVTIGLAA GTLVGMAVIL TYILGWANVA FYVEVDPRVD AVSKALPGAN CGGCGFVGCG        60
     EYAEAVVMQG APVNKCAPGG ANCAAAIAQI MGVEVGEALP YRPIVHCGAH TKDKHGISDY       120
     RGEQRCVTAN IVADVQGCTY GCLGFGDCVE ACAYDAIHVI NGLAVVDYTA CVGCGACAKA       180
     CPRNIITMTP FKADRVFAVL CSNKDAGKEV KKVCDVGCLG CKACERACGL FAIKDNLSCI       240
     NYDDYDPEHL EDIFKAIDKC PQKGIVLVGK PSEKDMAAVA DKEAPSVVTP DFKTTVDDTE       300
     WRG                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page