(data stored in ACNUC7421 zone)

EMBL: CP000859.PE316

CP000859.PE316       Location/Qualifiers
FT   CDS             362111..362950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0316"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   mta:Moth_1518 oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66126"
FT                   /db_xref="GOA:A8ZSW2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW2"
FT                   /protein_id="ABW66126.1"
FT                   /translation="MFKIVKRQEMAQGTVVLNEIEAPLIAAKAKPGQFVILKANETGER
FT                   IPLTMADTDPEKGTITIIFMIVGKSTALFATLKEGDAYMDVIGPLGAPTHIEKLGKVIC
FT                   VGGGTGVAVLHPITRALKEAGNHVFCVIGARNKDLLILEEQMKAASSDLRVCTDDGSYG
FT                   HHGFVTDVLKSILTENNDIKLVVAIGPVPMMKACSNLTKEFGVKTMVSLNPIMVDGTGM
FT                   CGGCRVSVGGETKFACVDGPEFDGHQVDFDELALRLRAYTADEKESHACFLNKAKQG"
     MFKIVKRQEM AQGTVVLNEI EAPLIAAKAK PGQFVILKAN ETGERIPLTM ADTDPEKGTI        60
     TIIFMIVGKS TALFATLKEG DAYMDVIGPL GAPTHIEKLG KVICVGGGTG VAVLHPITRA       120
     LKEAGNHVFC VIGARNKDLL ILEEQMKAAS SDLRVCTDDG SYGHHGFVTD VLKSILTENN       180
     DIKLVVAIGP VPMMKACSNL TKEFGVKTMV SLNPIMVDGT GMCGGCRVSV GGETKFACVD       240
     GPEFDGHQVD FDELALRLRA YTADEKESHA CFLNKAKQG                              279
//

If you have problems or comments...

PBIL Back to PBIL home page