(data stored in ACNUC7421 zone)

EMBL: CP000859.PE319

CP000859.PE319       Location/Qualifiers
FT   CDS             365131..365466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66129"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW5"
FT                   /protein_id="ABW66129.1"
FT                   /translation="MNASIDTILTTIGDTYKDRIDPRARHYLEINIGKQAEIMGLSGLP
FT                   DNLGAATAIVPLKAPAAGMKVRVDGRTFVDYAQFDSGVATPGYLARESGLAHAMFVPND
FT                   SMILNFA"
     MNASIDTILT TIGDTYKDRI DPRARHYLEI NIGKQAEIMG LSGLPDNLGA ATAIVPLKAP        60
     AAGMKVRVDG RTFVDYAQFD SGVATPGYLA RESGLAHAMF VPNDSMILNF A                111
//

If you have problems or comments...

PBIL Back to PBIL home page