(data stored in ACNUC7421 zone)

EMBL: CP000859.PE32

CP000859.PE32        Location/Qualifiers
FT   CDS             complement(37152..37847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsl:LSL_1540 ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS5"
FT                   /protein_id="ABW65842.1"
FT                   /translation="MAWRPRQKSASMSLIELSNYTVARNELRLKNISLAISPGQCWLVA
FT                   SDLRESAGLLFAALATLVKPETGTFRFKNALLDFSTYRQLLSCKREIGYVSPANVLLSN
FT                   RTILENLLLSDFYDKNTLSVTLDKKTDEMCLLFHIRNRLGQKVTEADRWDLRLAMAVRE
FT                   LAKDPAVLLVEWPEEVVPPDRQWMFVNLLQQALVSGTPLVIFSRDRSFCANFSASGKIV
FT                   IKGERVTVS"
     MAWRPRQKSA SMSLIELSNY TVARNELRLK NISLAISPGQ CWLVASDLRE SAGLLFAALA        60
     TLVKPETGTF RFKNALLDFS TYRQLLSCKR EIGYVSPANV LLSNRTILEN LLLSDFYDKN       120
     TLSVTLDKKT DEMCLLFHIR NRLGQKVTEA DRWDLRLAMA VRELAKDPAV LLVEWPEEVV       180
     PPDRQWMFVN LLQQALVSGT PLVIFSRDRS FCANFSASGK IVIKGERVTV S                231
//

If you have problems or comments...

PBIL Back to PBIL home page