(data stored in ACNUC7421 zone)

EMBL: CP000859.PE321

CP000859.PE321       Location/Qualifiers
FT   CDS             complement(366345..366842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0321"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24 and
FT                   S26 domain protein; KEGG: sth:STH2445 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66131"
FT                   /db_xref="GOA:A8ZSW7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSW7"
FT                   /protein_id="ABW66131.1"
FT                   /translation="MNKNRLQRFLFPALSRRYMLRVVLVAAGAFLFFGYVCIPFRIQGH
FT                   SMAPTYENGAVNFCFALRYLFSDPSPPDVVAVRLAGTRVMLLKRVVATKGQAVAFRNGF
FT                   LFVDGRKVAEPYVEKKSDWSLPSRTVKPGHVYVVGDNRSVPIENHQFGQTPTTRIVGVP
FT                   LW"
     MNKNRLQRFL FPALSRRYML RVVLVAAGAF LFFGYVCIPF RIQGHSMAPT YENGAVNFCF        60
     ALRYLFSDPS PPDVVAVRLA GTRVMLLKRV VATKGQAVAF RNGFLFVDGR KVAEPYVEKK       120
     SDWSLPSRTV KPGHVYVVGD NRSVPIENHQ FGQTPTTRIV GVPLW                       165
//

If you have problems or comments...

PBIL Back to PBIL home page