(data stored in ACNUC7421 zone)

EMBL: CP000859.PE329

CP000859.PE329       Location/Qualifiers
FT   CDS             complement(376692..379655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0329"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB short domain; KEGG: gme:Gmet_0975 type II and
FT                   III secretion system protein:NolW-like:secretin/TonB,
FT                   short-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66139"
FT                   /db_xref="GOA:A8ZSX5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX5"
FT                   /protein_id="ABW66139.1"
FT                   /translation="MHRMNAKKAAKVRGTLYFLSAILMVAMIAGCTPSAGVRQGTEATA
FT                   PEATSDTGQLARRITGISVKDTPDAVVVSIQTNHLADYTLAEPPLEQAVVLYFPEAGLA
FT                   TTTADPAEPNDLVGTVTAAELIAGGPSKVVIPMQQPGLAYEAMRGQDNSLNILFNKTAV
FT                   SPAPEAAWGQEEAAETVAAAETKEDASSVVEDATPAAPATLMEDITVTGDADALDITIL
FT                   ADGAITDHKLRILKAPPRIVYDLPGIRSTHAGEQRIAVDSAIAGRVRHFAHPDYLRVVV
FT                   DLKDDLYLGKARAYSLSNGLLIHVGEKETPALAAARKTGPVTTEARTSVAEAASVEPVD
FT                   ASPAVAPAPAEQEAEPAPAVAVKRSGKPAMVNRIDFMEEMDGRSAIEIGTTRPVDYEML
FT                   TISGNQLFLKLDNTDILSYRQRPLITTRFESAVDLILPVQTKKMKEQRFSAVNIDLREA
FT                   VPYTIKQMDNTIRILFEPSSVAPNPAKEVVIPTELAIESLVTDTAGAPDIETAVTEPAP
FT                   ASEAPVTPPETDVPAPIGTVAAPEAAVPQTAPAFEAPTGMRTEPDAPAPSLFGKKKNFT
FT                   GEPIALDFYKTDIRNVIRILKDVSGKNFAIDDDVSGSVTLSFVNPVPWDQVLDLILEMN
FT                   NLGMVEADGIIRIATQATLVQQKESEKAALTAQQDMKKAEETLASLVTEYFSISYANAG
FT                   EDILPHIEGLLSDRGHAKVDNRTNQVIMTDVEEKVEKAREIIAKIDKVTPQVMIKARIV
FT                   ETSSSFSREFGTEWGIDNRYNSPNINIGTDGAYRDEMGGTYTYDVALNSLSSPVQNLIG
FT                   INFARIIGTPFSLDAKLSLMESTGDVKIISTPKVVTLDNKTATISQGIDYPYTVVEDGE
FT                   ADVKWKTIDLNLDVTPHVTPDDRISMKLNIQKNDVGEIINGEQSFNTKRASTELLVNDG
FT                   DTVVIGGIIKEREGAGERGVPWISKIPVLGNLFKYKTRSDEKSELLIFITPNVVRLD"
     MHRMNAKKAA KVRGTLYFLS AILMVAMIAG CTPSAGVRQG TEATAPEATS DTGQLARRIT        60
     GISVKDTPDA VVVSIQTNHL ADYTLAEPPL EQAVVLYFPE AGLATTTADP AEPNDLVGTV       120
     TAAELIAGGP SKVVIPMQQP GLAYEAMRGQ DNSLNILFNK TAVSPAPEAA WGQEEAAETV       180
     AAAETKEDAS SVVEDATPAA PATLMEDITV TGDADALDIT ILADGAITDH KLRILKAPPR       240
     IVYDLPGIRS THAGEQRIAV DSAIAGRVRH FAHPDYLRVV VDLKDDLYLG KARAYSLSNG       300
     LLIHVGEKET PALAAARKTG PVTTEARTSV AEAASVEPVD ASPAVAPAPA EQEAEPAPAV       360
     AVKRSGKPAM VNRIDFMEEM DGRSAIEIGT TRPVDYEMLT ISGNQLFLKL DNTDILSYRQ       420
     RPLITTRFES AVDLILPVQT KKMKEQRFSA VNIDLREAVP YTIKQMDNTI RILFEPSSVA       480
     PNPAKEVVIP TELAIESLVT DTAGAPDIET AVTEPAPASE APVTPPETDV PAPIGTVAAP       540
     EAAVPQTAPA FEAPTGMRTE PDAPAPSLFG KKKNFTGEPI ALDFYKTDIR NVIRILKDVS       600
     GKNFAIDDDV SGSVTLSFVN PVPWDQVLDL ILEMNNLGMV EADGIIRIAT QATLVQQKES       660
     EKAALTAQQD MKKAEETLAS LVTEYFSISY ANAGEDILPH IEGLLSDRGH AKVDNRTNQV       720
     IMTDVEEKVE KAREIIAKID KVTPQVMIKA RIVETSSSFS REFGTEWGID NRYNSPNINI       780
     GTDGAYRDEM GGTYTYDVAL NSLSSPVQNL IGINFARIIG TPFSLDAKLS LMESTGDVKI       840
     ISTPKVVTLD NKTATISQGI DYPYTVVEDG EADVKWKTID LNLDVTPHVT PDDRISMKLN       900
     IQKNDVGEII NGEQSFNTKR ASTELLVNDG DTVVIGGIIK EREGAGERGV PWISKIPVLG       960
     NLFKYKTRSD EKSELLIFIT PNVVRLD                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page