(data stored in ACNUC7421 zone)

EMBL: CP000859.PE330

CP000859.PE330       Location/Qualifiers
FT   CDS             complement(379659..380639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ang:An01g09380 hypothetical protein Pfam:
FT                   Extensin_2 Troponin"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66140"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSX6"
FT                   /protein_id="ABW66140.1"
FT                   /translation="MMRVRKNLIICLVCVCLAAGVGCKKGADNPPEQAEPARQTISMEQ
FT                   PAPAPPAEQPTAPEVMVVEEEAPGPMVVTGTPQVPAETTPPASGPATETEPVAKKAAEG
FT                   PSAEEQQAPSDMPPTPAEEPPAPPVEAVSDSPALTDTADPEETDIALPTSEVEAGAGTV
FT                   DGTAMETTDEMEEAPADDVASEIKIVIDLMGEEDLDAEEAAKTTAENQALAMFSPFTPL
FT                   FQKDASEDDMFLEQDSQRKRAFLTPLERISLGQLQLSGIIRAASGNRAIVTDATGKGYV
FT                   VKKGTYIGLNSGQVEEIVDDRVIVVEMVGGRRAVTELKLQKPAGE"
     MMRVRKNLII CLVCVCLAAG VGCKKGADNP PEQAEPARQT ISMEQPAPAP PAEQPTAPEV        60
     MVVEEEAPGP MVVTGTPQVP AETTPPASGP ATETEPVAKK AAEGPSAEEQ QAPSDMPPTP       120
     AEEPPAPPVE AVSDSPALTD TADPEETDIA LPTSEVEAGA GTVDGTAMET TDEMEEAPAD       180
     DVASEIKIVI DLMGEEDLDA EEAAKTTAEN QALAMFSPFT PLFQKDASED DMFLEQDSQR       240
     KRAFLTPLER ISLGQLQLSG IIRAASGNRA IVTDATGKGY VVKKGTYIGL NSGQVEEIVD       300
     DRVIVVEMVG GRRAVTELKL QKPAGE                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page