(data stored in ACNUC7421 zone)

EMBL: CP000859.PE34

CP000859.PE34        Location/Qualifiers
FT   CDS             38838..41114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0034"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   CHASE2 domain protein; Tetratricopeptide TPR_2 repeat
FT                   protein; KEGG: sat:SYN_01481 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65844"
FT                   /db_xref="GOA:A8ZRS7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS7"
FT                   /protein_id="ABW65844.1"
FT                   /translation="MDLLKKSGRAIKTVFSRKPLLLSFCIVVAGALVFMSGISFLDIIE
FT                   LKTIDMRFKLRGDIPPGDRVVLAAIDEKSLKQEGRWVWPRTKIAALVDKLSEKGARVIA
FT                   FDVGFFEPESSEVIQTIGRIQAASKDNALRNKRFDDYLATLKNRSDNDRILVEAIQRSR
FT                   ATVVLGFFFQMNPEDALHITEAEIETHTRQIAGGRYTIERFSSDRAREAWLYRVAAPQS
FT                   NIQAISEATSYAGYFNKLADPDGVVRRMTMVMQFNNTLYAPLSLKAAGAYLDAPLSITV
FT                   EEDYGVASLMLGDLSIPVDERGDLLINYRGPEKTFPHISVTDILNDTVDESLIRDKIVL
FT                   VGATAIGIHDECVTPVAKVFPGPEVHLNVIDAILSEDFLFHPAWAALFDLLVIIGGGML
FT                   LAYVLLKTSALPGGLAMAAMFGGYLWLCQFFFTHMGWILNMVYPLCVFLAIYLFVTSYK
FT                   YLSEEGQKKFIREAFSKYLAPEVVNQLISSPQKLVLGGERREITAFFSDVQGFTSISEK
FT                   LAPEELVELLNDFLTEVTDIILHHKGAVDKFEGDAVIAFFGAPNELPNHPEAACLACID
FT                   IQKRMVELRAKWREQGKPELKVRIGLYSGPAVVGNMGSRNRMDYTMMGDTVNTAARLEG
FT                   VNKIYGTYTMVGQPTYEAAADALFARELDAVTVVGKKTPVAIYEVLGRRGEVDETGVKT
FT                   TEVYAKGLAAYRQRQWDQAVAWFKEALAVTPDDGPSLTMIRRCEAYAENPPPDDWNGAF
FT                   SMMTK"
     MDLLKKSGRA IKTVFSRKPL LLSFCIVVAG ALVFMSGISF LDIIELKTID MRFKLRGDIP        60
     PGDRVVLAAI DEKSLKQEGR WVWPRTKIAA LVDKLSEKGA RVIAFDVGFF EPESSEVIQT       120
     IGRIQAASKD NALRNKRFDD YLATLKNRSD NDRILVEAIQ RSRATVVLGF FFQMNPEDAL       180
     HITEAEIETH TRQIAGGRYT IERFSSDRAR EAWLYRVAAP QSNIQAISEA TSYAGYFNKL       240
     ADPDGVVRRM TMVMQFNNTL YAPLSLKAAG AYLDAPLSIT VEEDYGVASL MLGDLSIPVD       300
     ERGDLLINYR GPEKTFPHIS VTDILNDTVD ESLIRDKIVL VGATAIGIHD ECVTPVAKVF       360
     PGPEVHLNVI DAILSEDFLF HPAWAALFDL LVIIGGGMLL AYVLLKTSAL PGGLAMAAMF       420
     GGYLWLCQFF FTHMGWILNM VYPLCVFLAI YLFVTSYKYL SEEGQKKFIR EAFSKYLAPE       480
     VVNQLISSPQ KLVLGGERRE ITAFFSDVQG FTSISEKLAP EELVELLNDF LTEVTDIILH       540
     HKGAVDKFEG DAVIAFFGAP NELPNHPEAA CLACIDIQKR MVELRAKWRE QGKPELKVRI       600
     GLYSGPAVVG NMGSRNRMDY TMMGDTVNTA ARLEGVNKIY GTYTMVGQPT YEAAADALFA       660
     RELDAVTVVG KKTPVAIYEV LGRRGEVDET GVKTTEVYAK GLAAYRQRQW DQAVAWFKEA       720
     LAVTPDDGPS LTMIRRCEAY AENPPPDDWN GAFSMMTK                               758
//

If you have problems or comments...

PBIL Back to PBIL home page