(data stored in ACNUC7421 zone)

EMBL: CP000859.PE340

CP000859.PE340       Location/Qualifiers
FT   CDS             390277..391122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66150"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY6"
FT                   /protein_id="ABW66150.1"
FT                   /translation="MTPRFKPAFMLLILVGTCLWGVLPAAGYVPPGELILDRMTSTLGR
FT                   TGKFSVVHTTAVADTACPPLHEATATETAWYDPPDRFRFESVFKKVKRIYVATPEAALT
FT                   IVDGHVVSTAQSPLMRYREPLLCRDRKLLAARLVGMGIDTTVSSLGRLDGTVAYVVGAR
FT                   FPDASASQLWVAKETFLPFRLIINDSRERTQVEARYSQWHKEGAFWFPMHIEIYRNHRL
FT                   IQTICSHTVTKKSVFESGLFDITALQRRYPPADAAEGRPPDSSTDEIQQAIDNFNKLYE
FT                   "
     MTPRFKPAFM LLILVGTCLW GVLPAAGYVP PGELILDRMT STLGRTGKFS VVHTTAVADT        60
     ACPPLHEATA TETAWYDPPD RFRFESVFKK VKRIYVATPE AALTIVDGHV VSTAQSPLMR       120
     YREPLLCRDR KLLAARLVGM GIDTTVSSLG RLDGTVAYVV GARFPDASAS QLWVAKETFL       180
     PFRLIINDSR ERTQVEARYS QWHKEGAFWF PMHIEIYRNH RLIQTICSHT VTKKSVFESG       240
     LFDITALQRR YPPADAAEGR PPDSSTDEIQ QAIDNFNKLY E                           281
//

If you have problems or comments...

PBIL Back to PBIL home page