(data stored in ACNUC7421 zone)

EMBL: CP000859.PE342

CP000859.PE342       Location/Qualifiers
FT   CDS             392810..393523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0342"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; FeoA family protein;
FT                   KEGG: gsu:GSU1379 ferric uptake regulation protein Fur"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66152"
FT                   /db_xref="GOA:A8ZSY8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSY8"
FT                   /protein_id="ABW66152.1"
FT                   /translation="MFPLKKSAMTKLHDREKSQFKKLFRNEGVDRFEEMMTVLEVFLET
FT                   EGHITANELIDRLTEHGFDFDPSFVRDSLRLLTQFGFAKKLRFDDGKIRYEHCHLGDHH
FT                   DHMLCRKCGKIIEFVDDALETIQAEVAAAHGFHMLGHRMDIYGICADCLKNRIRVIPLS
FT                   RARQGEHLVIEEFTGGTNARMRLMSMGLKTGDPVEVITSDPRGQVVIASGNKRYAIGRG
FT                   LAGKVMARHTDDPAA"
     MFPLKKSAMT KLHDREKSQF KKLFRNEGVD RFEEMMTVLE VFLETEGHIT ANELIDRLTE        60
     HGFDFDPSFV RDSLRLLTQF GFAKKLRFDD GKIRYEHCHL GDHHDHMLCR KCGKIIEFVD       120
     DALETIQAEV AAAHGFHMLG HRMDIYGICA DCLKNRIRVI PLSRARQGEH LVIEEFTGGT       180
     NARMRLMSMG LKTGDPVEVI TSDPRGQVVI ASGNKRYAIG RGLAGKVMAR HTDDPAA          237
//

If you have problems or comments...

PBIL Back to PBIL home page