(data stored in ACNUC7421 zone)

EMBL: CP000859.PE346

CP000859.PE346       Location/Qualifiers
FT   CDS             396889..397338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0346"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; SH3 type
FT                   3 domain protein; SMART: SH3 domain protein; KEGG:
FT                   dps:DP2276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66156"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ2"
FT                   /protein_id="ABW66156.1"
FT                   /translation="MTNLRLFQSFCMVFICALLVAAPAFSQERLSVTATTANIRTGPGT
FT                   SYDKAWQAEKNYPVVVVEKKDGWVKFKDYEGDEGWIYGALVSATSTVIVKKTRVNVRSG
FT                   PGTNHPVVFEAEKGVPFEVIKNDGDWLQIKHADGDTGWIYRPLVW"
     MTNLRLFQSF CMVFICALLV AAPAFSQERL SVTATTANIR TGPGTSYDKA WQAEKNYPVV        60
     VVEKKDGWVK FKDYEGDEGW IYGALVSATS TVIVKKTRVN VRSGPGTNHP VVFEAEKGVP       120
     FEVIKNDGDW LQIKHADGDT GWIYRPLVW                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page