(data stored in ACNUC7421 zone)

EMBL: CP000859.PE348

CP000859.PE348       Location/Qualifiers
FT   CDS             complement(399063..399977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0348"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: protein of unknown function DUF362; KEGG:
FT                   gsu:GSU2682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66158"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ4"
FT                   /protein_id="ABW66158.1"
FT                   /translation="MDRRQFLKHLALWYAGMVATAPVFRLPAEALALPSEKPEIVVGRG
FT                   QDYPALVKAVIRQAGGMERFVKKGHRVVIKPNIGWDRTPEQGANTHPLVVRTLVELALG
FT                   AGAASVSVFDRTCNEERRCYQNSGIKPVLDAMGDRRVRCEFIDDRRFVPVTIARGKALT
FT                   EWPFYKEALAADCYINVPVAKHHGLTGVTLGLKNIMGIIGGSRGQIHHRIDQNLADLNS
FT                   VLRPDLTVVDATRILTKNGPQGGSLEDVSIRHTVFVSTDPVAADAYGTTLFDLAPDAVA
FT                   PTVAAYKMGLGEMDMDKCRIIEV"
     MDRRQFLKHL ALWYAGMVAT APVFRLPAEA LALPSEKPEI VVGRGQDYPA LVKAVIRQAG        60
     GMERFVKKGH RVVIKPNIGW DRTPEQGANT HPLVVRTLVE LALGAGAASV SVFDRTCNEE       120
     RRCYQNSGIK PVLDAMGDRR VRCEFIDDRR FVPVTIARGK ALTEWPFYKE ALAADCYINV       180
     PVAKHHGLTG VTLGLKNIMG IIGGSRGQIH HRIDQNLADL NSVLRPDLTV VDATRILTKN       240
     GPQGGSLEDV SIRHTVFVST DPVAADAYGT TLFDLAPDAV APTVAAYKMG LGEMDMDKCR       300
     IIEV                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page