(data stored in ACNUC7421 zone)

EMBL: CP000859.PE350

CP000859.PE350       Location/Qualifiers
FT   CDS             complement(401974..403245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0350"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: ppd:Ppro_0129
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66160"
FT                   /db_xref="GOA:A8ZSZ6"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ6"
FT                   /protein_id="ABW66160.1"
FT                   /translation="MQTEKDIKTVAVIGGGVTGIVAAYLMDRKYKVTLFEKNDYLGGHT
FT                   NTQLVADGSGSQVPVDTGFIVFNDRTYPHFTTFLKQLKVAAADAPMSFGYYNRAKDVQF
FT                   CSRVPGGLFADRKNLFRPWYWRMVGEILRFNRQARRDLYGGRLGDMTLGDYLSVNRYSP
FT                   AFQDYYLLPMAGAIWSSPAGHINRFPCESFFRFYDNHGLLSATDHPQWKTICNGSVQYV
FT                   RAFEKVFTGQVRLNASVLNVARTAEGVMVTTTDGPPAVFDAAIIASHADQALAMLEDPD
FT                   ETEKTVLGAWTYSRNTTVLHGDRSLMPPSVRAWAAWNYMDDGTPASRVALTYYMNMLQG
FT                   LPGGRDFFVTLNAPWPIKPEAITYQVLYEHPIYDTAALVSQKHLPLIRPERNTYFCGSY
FT                   CGYGFHEDGTRAAVTVARHLGVEL"
     MQTEKDIKTV AVIGGGVTGI VAAYLMDRKY KVTLFEKNDY LGGHTNTQLV ADGSGSQVPV        60
     DTGFIVFNDR TYPHFTTFLK QLKVAAADAP MSFGYYNRAK DVQFCSRVPG GLFADRKNLF       120
     RPWYWRMVGE ILRFNRQARR DLYGGRLGDM TLGDYLSVNR YSPAFQDYYL LPMAGAIWSS       180
     PAGHINRFPC ESFFRFYDNH GLLSATDHPQ WKTICNGSVQ YVRAFEKVFT GQVRLNASVL       240
     NVARTAEGVM VTTTDGPPAV FDAAIIASHA DQALAMLEDP DETEKTVLGA WTYSRNTTVL       300
     HGDRSLMPPS VRAWAAWNYM DDGTPASRVA LTYYMNMLQG LPGGRDFFVT LNAPWPIKPE       360
     AITYQVLYEH PIYDTAALVS QKHLPLIRPE RNTYFCGSYC GYGFHEDGTR AAVTVARHLG       420
     VEL                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page