(data stored in ACNUC7421 zone)

EMBL: CP000859.PE354

CP000859.PE354       Location/Qualifiers
FT   CDS             complement(405885..406475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66164"
FT                   /db_xref="GOA:A8ZT00"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT00"
FT                   /protein_id="ABW66164.1"
FT                   /translation="MRIMPKQRFINRLVTTWVLIFCFTTGLYGAQVNGADFEKAVYVSE
FT                   KRLTLRGAGLLRYLVVIKAYAGAFYLEAGLPPDRALENVTRQLVLHYFHAIPAEDFATA
FT                   TTTMIEKNVTPDQFARLAPLVDRMNALYRDVAPGDRYTATYIPESGTELALNGQALGTV
FT                   PGAAFSRAFFSIWIGENPIDKGFRNDLLKGLAP"
     MRIMPKQRFI NRLVTTWVLI FCFTTGLYGA QVNGADFEKA VYVSEKRLTL RGAGLLRYLV        60
     VIKAYAGAFY LEAGLPPDRA LENVTRQLVL HYFHAIPAED FATATTTMIE KNVTPDQFAR       120
     LAPLVDRMNA LYRDVAPGDR YTATYIPESG TELALNGQAL GTVPGAAFSR AFFSIWIGEN       180
     PIDKGFRNDL LKGLAP                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page