(data stored in ACNUC7421 zone)

EMBL: CP000859.PE356

CP000859.PE356       Location/Qualifiers
FT   CDS             407493..408407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0356"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: dde:Dde_3135 regulatory
FT                   protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66166"
FT                   /db_xref="GOA:A8ZT02"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT02"
FT                   /protein_id="ABW66166.1"
FT                   /translation="MHIIKYLKAISDETRLRLLFLLLHYELNVNEVVAVVEMIQSRVSR
FT                   HLKILTESGLLQFRRDGGFVYYSALTDEANGPVVRLVADALADDPVCEADLGRAEALIR
FT                   ERKSRTKRFFESVADTWEVRKHDVLGDLDLNRILADRVGNCPVAADLGCGTGALLAALN
FT                   GQVPTVIGVDSSPGMLEQARLKTAAMAGVNLRLGELEYLPMRDREAHCAVMNMVLHHIS
FT                   EPVKVLAEAYRILHPGGTFFIADFDKHNKVAVREKIGGSWFGFSQNEMDAWLAGAGFVP
FT                   AGLERFAVNYGLTVNLFVSKKQQ"
     MHIIKYLKAI SDETRLRLLF LLLHYELNVN EVVAVVEMIQ SRVSRHLKIL TESGLLQFRR        60
     DGGFVYYSAL TDEANGPVVR LVADALADDP VCEADLGRAE ALIRERKSRT KRFFESVADT       120
     WEVRKHDVLG DLDLNRILAD RVGNCPVAAD LGCGTGALLA ALNGQVPTVI GVDSSPGMLE       180
     QARLKTAAMA GVNLRLGELE YLPMRDREAH CAVMNMVLHH ISEPVKVLAE AYRILHPGGT       240
     FFIADFDKHN KVAVREKIGG SWFGFSQNEM DAWLAGAGFV PAGLERFAVN YGLTVNLFVS       300
     KKQQ                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page