(data stored in ACNUC7421 zone)

EMBL: CP000859.PE358

CP000859.PE358       Location/Qualifiers
FT   CDS             410474..411991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0358"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: plu:plu1308 apolipoprotein
FT                   N-acyltransferase (ALP N-acyltransferase) (copper
FT                   homeostasis protein CutE)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66168"
FT                   /db_xref="GOA:A8ZT04"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT04"
FT                   /protein_id="ABW66168.1"
FT                   /translation="MVLASLSGILFTVAFSVKPLWWVSFAALFPLLLSLDRARTWRAAA
FT                   VRMSLFSIVFSFGMGYWVFHALVGHYQLPAGTAVSFFILALVLPVWLMHLTIALFYRFL
FT                   NNRTPVFYALVVPCLWVLGDYVKGMIPLLVPWGDIGYALVDWGAYFQMADLGGVYLVSF
FT                   LVVMFNSLLVCLMECRPQTNDLFRRRPMKGRAGTAVLILLVLILLVPLCYGSVRRYRMP
FT                   VLSLAGEKTPAVIAQGNFSHKDRWGGLGFYQRLKTYIELSGDPSDMGKAGVIVWPETVL
FT                   NHPEALTGPFFADLARILGKENLLIAGGLKRDSQSQGVYNSVYVIEDGQLKRYDKHILL
FT                   PYSERGPAVGPLFRFYNAPDRFIPGTTPACLSTSHGRVGLSVCFEILYPGYVRLSVKQG
FT                   AEFLVNVSNDAWFGDSAMPRAHLRAARARAVETGRWLLRASNSGISAVIAPNGSLTAGS
FT                   DLFRTQRISGSFTRLTTTTVYTRWGEWLFFFCLAVPAISLLRAGVRR"
     MVLASLSGIL FTVAFSVKPL WWVSFAALFP LLLSLDRART WRAAAVRMSL FSIVFSFGMG        60
     YWVFHALVGH YQLPAGTAVS FFILALVLPV WLMHLTIALF YRFLNNRTPV FYALVVPCLW       120
     VLGDYVKGMI PLLVPWGDIG YALVDWGAYF QMADLGGVYL VSFLVVMFNS LLVCLMECRP       180
     QTNDLFRRRP MKGRAGTAVL ILLVLILLVP LCYGSVRRYR MPVLSLAGEK TPAVIAQGNF       240
     SHKDRWGGLG FYQRLKTYIE LSGDPSDMGK AGVIVWPETV LNHPEALTGP FFADLARILG       300
     KENLLIAGGL KRDSQSQGVY NSVYVIEDGQ LKRYDKHILL PYSERGPAVG PLFRFYNAPD       360
     RFIPGTTPAC LSTSHGRVGL SVCFEILYPG YVRLSVKQGA EFLVNVSNDA WFGDSAMPRA       420
     HLRAARARAV ETGRWLLRAS NSGISAVIAP NGSLTAGSDL FRTQRISGSF TRLTTTTVYT       480
     RWGEWLFFFC LAVPAISLLR AGVRR                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page