(data stored in ACNUC7421 zone)

EMBL: CP000859.PE365

CP000859.PE365       Location/Qualifiers
FT   CDS             422177..423046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0365"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sfu:Sfum_0717 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66175"
FT                   /db_xref="GOA:A8ZT11"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT11"
FT                   /protein_id="ABW66175.1"
FT                   /translation="MHYEGNMIRPPSEAYSILLQATVGCSHNKCTFCAAYKGERFKIKS
FT                   DDIIMSDIEFAARHCRNQDRLFICDGDALIIPQKRLLAILKEIEQKLPWVNRVGVYANT
FT                   KGIAMKTSEELAELRAHGLKIAYMGLESGDDETLKAVNKGADSQKMIDMGKKIRAAGVA
FT                   LSITVLLGLAGRERSEIHAQKTGEVLSAIDPEYVGALSLMLIPGTPLYDEYAAGRFPIL
FT                   TPEETLVELRTMITHTNLSNGLFHANHASNYLPIRAKLPEDKASTLRLINQALAGKIRL
FT                   KPEHMRGL"
     MHYEGNMIRP PSEAYSILLQ ATVGCSHNKC TFCAAYKGER FKIKSDDIIM SDIEFAARHC        60
     RNQDRLFICD GDALIIPQKR LLAILKEIEQ KLPWVNRVGV YANTKGIAMK TSEELAELRA       120
     HGLKIAYMGL ESGDDETLKA VNKGADSQKM IDMGKKIRAA GVALSITVLL GLAGRERSEI       180
     HAQKTGEVLS AIDPEYVGAL SLMLIPGTPL YDEYAAGRFP ILTPEETLVE LRTMITHTNL       240
     SNGLFHANHA SNYLPIRAKL PEDKASTLRL INQALAGKIR LKPEHMRGL                   289
//

If you have problems or comments...

PBIL Back to PBIL home page