(data stored in ACNUC7421 zone)

EMBL: CP000859.PE369

CP000859.PE369       Location/Qualifiers
FT   CDS             complement(426552..427478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0369"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: Prophage CP4-57 regulatory; KEGG: pca:Pcar_0674
FT                   periplasmic molybdate-binding protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66179"
FT                   /db_xref="GOA:A8ZT15"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT15"
FT                   /protein_id="ABW66179.1"
FT                   /translation="MAQLLSTKELAQLLGIHEKKVYKLITEQRMPATKVTGKWLFPKHL
FT                   VEQWIAANTINHPGEASCLIDTPSLLVVAGSNDILLDRAMALFMKHHPEITVVFGNLGS
FT                   MGGLRALGRGVCHMASSHLVQEDEAEYNFSFAAKEMENMPAVVNFCFREQGLVLPKGNP
FT                   KTVAGMADLARKKLTIVNRAHGTGTRLWFDRKLKEAGVSPGTLKGYDHDVQRHLDVGLE
FT                   VLSGRADTGPAIRAVAQLLDLDFLPMHWERFDLLIPRSLFFDKKIQAFLSMLTDPAFTG
FT                   LAETLAGYDLSKSGKMVYPQDQKKESA"
     MAQLLSTKEL AQLLGIHEKK VYKLITEQRM PATKVTGKWL FPKHLVEQWI AANTINHPGE        60
     ASCLIDTPSL LVVAGSNDIL LDRAMALFMK HHPEITVVFG NLGSMGGLRA LGRGVCHMAS       120
     SHLVQEDEAE YNFSFAAKEM ENMPAVVNFC FREQGLVLPK GNPKTVAGMA DLARKKLTIV       180
     NRAHGTGTRL WFDRKLKEAG VSPGTLKGYD HDVQRHLDVG LEVLSGRADT GPAIRAVAQL       240
     LDLDFLPMHW ERFDLLIPRS LFFDKKIQAF LSMLTDPAFT GLAETLAGYD LSKSGKMVYP       300
     QDQKKESA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page