(data stored in ACNUC7421 zone)

EMBL: CP000859.PE370

CP000859.PE370       Location/Qualifiers
FT   CDS             427693..428667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0370"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein; KEGG:
FT                   sfu:Sfum_0851 phosphoesterase, RecJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66180"
FT                   /db_xref="GOA:A8ZT16"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT16"
FT                   /protein_id="ABW66180.1"
FT                   /translation="MSVSNTERVRLFYSRFSGTDHVLVVINADPDAIGSAMAVKRLLWK
FT                   KAASVTLSNINVIDRPDNLAMVRLLGVKLVHIDTIDVSRYTRVVMVDSQPDHNERLAGI
FT                   TADVIIDHHPVAVKSTASYADIRPDYGATSTMLIEYLKAARIKPSRKLATGLYLGIKTD
FT                   TSNFERHATPEDVRAFQYIFRYVNVHLARRIEQAEIKPEFLAYFSKALNRKVMRRKKAF
FT                   IHLGRVVNPDVCVLVADFFMRVSSVQWSIVSGVYDDRLIVILRNDGIRRDAGQAAKKAF
FT                   EQMGSAGGHRSMARAEIPIGAVYKEVKKKEEKEIARWVIRKLK"
     MSVSNTERVR LFYSRFSGTD HVLVVINADP DAIGSAMAVK RLLWKKAASV TLSNINVIDR        60
     PDNLAMVRLL GVKLVHIDTI DVSRYTRVVM VDSQPDHNER LAGITADVII DHHPVAVKST       120
     ASYADIRPDY GATSTMLIEY LKAARIKPSR KLATGLYLGI KTDTSNFERH ATPEDVRAFQ       180
     YIFRYVNVHL ARRIEQAEIK PEFLAYFSKA LNRKVMRRKK AFIHLGRVVN PDVCVLVADF       240
     FMRVSSVQWS IVSGVYDDRL IVILRNDGIR RDAGQAAKKA FEQMGSAGGH RSMARAEIPI       300
     GAVYKEVKKK EEKEIARWVI RKLK                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page