(data stored in ACNUC7421 zone)

EMBL: CP000859.PE371

CP000859.PE371       Location/Qualifiers
FT   CDS             complement(428881..429621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0371"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   gme:Gmet_0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66181"
FT                   /db_xref="GOA:A8ZT17"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZT17"
FT                   /protein_id="ABW66181.1"
FT                   /translation="MSGHNKWSSIKHKKGAADAKRGKVFTKLIKEITLAARTGGGDPDG
FT                   NPRLRTAIAAAKDENMPKDNIERAIKKGTGDLEGVNYEENTYEGYGPGGAAVLVESLTD
FT                   NKNRAVSEIRHIFSKHNGNMGENGCVAWMFDKKGYIEVEKSAAEEDHLMEVAIEAGAED
FT                   VRESDDTFEVITEVEDLETVRQALDGASIQYAFAEITMLPQTMVDLDDKTSEQMIRLLD
FT                   ALDDCEDVQKVYTNASLSDSVGEA"
     MSGHNKWSSI KHKKGAADAK RGKVFTKLIK EITLAARTGG GDPDGNPRLR TAIAAAKDEN        60
     MPKDNIERAI KKGTGDLEGV NYEENTYEGY GPGGAAVLVE SLTDNKNRAV SEIRHIFSKH       120
     NGNMGENGCV AWMFDKKGYI EVEKSAAEED HLMEVAIEAG AEDVRESDDT FEVITEVEDL       180
     ETVRQALDGA SIQYAFAEIT MLPQTMVDLD DKTSEQMIRL LDALDDCEDV QKVYTNASLS       240
     DSVGEA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page