(data stored in ACNUC7421 zone)

EMBL: CP000859.PE373

CP000859.PE373       Location/Qualifiers
FT   CDS             complement(430413..431771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0373"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: ppd:Ppro_0422 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66183"
FT                   /db_xref="GOA:A8ZT19"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT19"
FT                   /protein_id="ABW66183.1"
FT                   /translation="MKTVFCCQSCGYQAPKWMGRCPECEGWGTFVEEPADGSASAAKSG
FT                   RGVKPAEAVALDAIELADERRIHTAIGEFDRVLGGGIVAGSLVLVGGDPGIGKSTLMLQ
FT                   AAQKLSENGCTVLYVSGEESLRQIKMRSRRLCPSLSSSLLAAAETDIERVTALARSAKP
FT                   DVMVIDSIQTMSSGDFSSAPGSVGQVREATMRLMALAKKTGICVFLIGHVTKDGSIAGP
FT                   RIMEHMVDTVLYFEGDKNQVFRILRAVKNRFGSTNEIGVFEMRTEGLGEVANPSAVFLS
FT                   EMPEKTPGSVVTASMEGTRPILVELQALASRTSLGMARRTILGLDANRVALLVAVMEKK
FT                   LGMELTGYDVFMNVAGGVRVSEPAVDLAVIAAVASSFLDRPIPTGTVVLGEVGLTGEVR
FT                   AINHIDTRVGEIKKMGFTACLLPQGNLKRMSRDKEIKVTGVGTVAEAMEVLFQ"
     MKTVFCCQSC GYQAPKWMGR CPECEGWGTF VEEPADGSAS AAKSGRGVKP AEAVALDAIE        60
     LADERRIHTA IGEFDRVLGG GIVAGSLVLV GGDPGIGKST LMLQAAQKLS ENGCTVLYVS       120
     GEESLRQIKM RSRRLCPSLS SSLLAAAETD IERVTALARS AKPDVMVIDS IQTMSSGDFS       180
     SAPGSVGQVR EATMRLMALA KKTGICVFLI GHVTKDGSIA GPRIMEHMVD TVLYFEGDKN       240
     QVFRILRAVK NRFGSTNEIG VFEMRTEGLG EVANPSAVFL SEMPEKTPGS VVTASMEGTR       300
     PILVELQALA SRTSLGMARR TILGLDANRV ALLVAVMEKK LGMELTGYDV FMNVAGGVRV       360
     SEPAVDLAVI AAVASSFLDR PIPTGTVVLG EVGLTGEVRA INHIDTRVGE IKKMGFTACL       420
     LPQGNLKRMS RDKEIKVTGV GTVAEAMEVL FQ                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page