(data stored in ACNUC7421 zone)

EMBL: CP000859.PE381

CP000859.PE381       Location/Qualifiers
FT   CDS             441315..441731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66191"
FT                   /db_xref="InterPro:IPR024208"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT27"
FT                   /protein_id="ABW66191.1"
FT                   /translation="MLRICVIDGQGGGIGAAAIKKIQEAFGETVEIIALGTNAIATAQM
FT                   LKAKANRGASGENAIVRTVAEADVIVGPIGIVMAHALMGEVTPAMAEAVSGCRAAKVLI
FT                   PLSQERVEIVGVAQEPLPHLLENLIEHHLKPKKR"
     MLRICVIDGQ GGGIGAAAIK KIQEAFGETV EIIALGTNAI ATAQMLKAKA NRGASGENAI        60
     VRTVAEADVI VGPIGIVMAH ALMGEVTPAM AEAVSGCRAA KVLIPLSQER VEIVGVAQEP       120
     LPHLLENLIE HHLKPKKR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page